BLASTX nr result
ID: Ophiopogon27_contig00041149
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00041149 (438 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY42466.1| hypothetical protein RhiirA4_397446 [Rhizophagus ... 46 5e-06 >gb|PKY42466.1| hypothetical protein RhiirA4_397446 [Rhizophagus irregularis] Length = 85 Score = 46.2 bits (108), Expect(2) = 5e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -2 Query: 119 FGKKRNVSLYSLYFRLRELLSAFTQTKEY*FLYQP 15 F + VSLYSLYFRLRELLSAFTQTK F P Sbjct: 19 FETTQAVSLYSLYFRLRELLSAFTQTKSIDFCINP 53 Score = 32.0 bits (71), Expect(2) = 5e-06 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 40 KSIDFCINPSDGL 2 KSIDFCINPSDGL Sbjct: 45 KSIDFCINPSDGL 57