BLASTX nr result
ID: Ophiopogon27_contig00040983
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00040983 (402 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POG78722.1| hypothetical protein GLOIN_2v1472844 [Rhizophagus... 79 1e-14 gb|PKK58668.1| hypothetical protein RhiirC2_857679 [Rhizophagus ... 79 1e-14 dbj|GBC51899.1| hypothetical protein RIR_3336300 [Rhizophagus ir... 79 2e-14 dbj|GBC32910.1| hypothetical protein RIR_1791400 [Rhizophagus ir... 79 2e-14 gb|PKK59296.1| hypothetical protein RhiirC2_857406, partial [Rhi... 77 3e-14 gb|POG58558.1| hypothetical protein GLOIN_2v1821171 [Rhizophagus... 78 5e-14 gb|POG72921.1| hypothetical protein GLOIN_2v1477388 [Rhizophagus... 78 5e-14 gb|PKB95905.1| hypothetical protein RhiirA5_507131 [Rhizophagus ... 78 5e-14 gb|PKC54334.1| hypothetical protein RhiirA1_447094 [Rhizophagus ... 78 5e-14 gb|EXX56163.1| hypothetical protein RirG_218640 [Rhizophagus irr... 78 5e-14 gb|PKK59049.1| hypothetical protein RhiirC2_795395 [Rhizophagus ... 78 5e-14 gb|EXX67380.1| hypothetical protein RirG_114910 [Rhizophagus irr... 78 5e-14 gb|POG65016.1| hypothetical protein GLOIN_2v1670108 [Rhizophagus... 78 5e-14 gb|POG61805.1| hypothetical protein GLOIN_2v1786107 [Rhizophagus... 77 1e-13 gb|PKC57818.1| hypothetical protein RhiirA1_541400 [Rhizophagus ... 77 1e-13 dbj|GBC28851.1| hypothetical protein RIR_1468300 [Rhizophagus ir... 77 1e-13 gb|PKK56963.1| hypothetical protein RhiirC2_798945 [Rhizophagus ... 74 2e-12 gb|PKK59642.1| hypothetical protein RhiirC2_820485 [Rhizophagus ... 74 2e-12 gb|PKC55633.1| hypothetical protein RhiirA1_113727 [Rhizophagus ... 72 2e-12 gb|PKK71366.1| hypothetical protein RhiirC2_429356 [Rhizophagus ... 72 3e-12 >gb|POG78722.1| hypothetical protein GLOIN_2v1472844 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 616 Score = 79.3 bits (194), Expect = 1e-14 Identities = 36/59 (61%), Positives = 45/59 (76%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTFY 224 G+MKL+VY TV YGKSH+LS IACF + G VV+ D QLAV+P DY+KSALFL ++ Sbjct: 232 GYMKLFVYGTVGYGKSHILSAIACFLFRTGRRVVFLPDCRQLAVDPVDYVKSALFLAYH 290 >gb|PKK58668.1| hypothetical protein RhiirC2_857679 [Rhizophagus irregularis] Length = 706 Score = 79.3 bits (194), Expect = 1e-14 Identities = 36/59 (61%), Positives = 45/59 (76%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTFY 224 G+MKL+VY TV YGKSH+LS IACF + G VVY D QL+V+P DY+KSALFL ++ Sbjct: 219 GYMKLFVYGTVGYGKSHILSAIACFLFRTGRRVVYIPDCRQLSVDPIDYVKSALFLAYH 277 >dbj|GBC51899.1| hypothetical protein RIR_3336300 [Rhizophagus irregularis DAOM 181602] Length = 778 Score = 79.3 bits (194), Expect = 2e-14 Identities = 36/59 (61%), Positives = 45/59 (76%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTFY 224 G+MKL+VY TV YGKSH+LS IACF + G VV+ D QLAV+P DY+KSALFL ++ Sbjct: 248 GYMKLFVYGTVGYGKSHILSAIACFLFRTGRRVVFLPDCRQLAVDPVDYVKSALFLAYH 306 >dbj|GBC32910.1| hypothetical protein RIR_1791400 [Rhizophagus irregularis DAOM 181602] Length = 801 Score = 79.3 bits (194), Expect = 2e-14 Identities = 36/59 (61%), Positives = 45/59 (76%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTFY 224 G+MKL+VY TV YGKSH+LS IACF + G VV+ D QLAV+P DY+KSALFL ++ Sbjct: 271 GYMKLFVYGTVGYGKSHILSAIACFLFRTGRRVVFLPDCRQLAVDPVDYVKSALFLAYH 329 >gb|PKK59296.1| hypothetical protein RhiirC2_857406, partial [Rhizophagus irregularis] Length = 245 Score = 76.6 bits (187), Expect = 3e-14 Identities = 35/59 (59%), Positives = 44/59 (74%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTFY 224 G+MKL+VY TV YGKSH+LS IACF + VVY D QL+V+P DY+KSALFL ++ Sbjct: 68 GYMKLFVYGTVGYGKSHILSAIACFLFRTERRVVYIPDCRQLSVDPVDYVKSALFLAYH 126 >gb|POG58558.1| hypothetical protein GLOIN_2v1821171 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 455 Score = 77.8 bits (190), Expect = 5e-14 Identities = 36/59 (61%), Positives = 44/59 (74%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTFY 224 G+MKL+VY TV YGKSH+LS IACF + G VV+ D QLAV+P DY KSALFL ++ Sbjct: 218 GYMKLFVYGTVGYGKSHILSAIACFLFRTGRRVVFLPDCRQLAVDPVDYTKSALFLAYH 276 >gb|POG72921.1| hypothetical protein GLOIN_2v1477388 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 583 Score = 77.8 bits (190), Expect = 5e-14 Identities = 36/59 (61%), Positives = 44/59 (74%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTFY 224 G+MKL+VY TV YGKSH+LS IACF + G VV+ D QLAV+P DY KSALFL ++ Sbjct: 68 GYMKLFVYGTVGYGKSHILSAIACFLFRTGRRVVFLPDCRQLAVDPVDYTKSALFLAYH 126 >gb|PKB95905.1| hypothetical protein RhiirA5_507131 [Rhizophagus irregularis] gb|PKY34251.1| hypothetical protein RhiirB3_532772 [Rhizophagus irregularis] Length = 587 Score = 77.8 bits (190), Expect = 5e-14 Identities = 36/59 (61%), Positives = 44/59 (74%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTFY 224 G+MKL+VY TV YGKSH+LS IACF + G VV+ D QLAV+P DY KSALFL ++ Sbjct: 68 GYMKLFVYGTVGYGKSHILSAIACFLFRTGRRVVFLPDCRQLAVDPVDYTKSALFLAYH 126 >gb|PKC54334.1| hypothetical protein RhiirA1_447094 [Rhizophagus irregularis] Length = 623 Score = 77.8 bits (190), Expect = 5e-14 Identities = 36/59 (61%), Positives = 44/59 (74%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTFY 224 G+MKL+VY TV YGKSH+LS IACF + G VV+ D QLAV+P DY KSALFL ++ Sbjct: 104 GYMKLFVYGTVGYGKSHILSAIACFLFRTGRRVVFLPDCRQLAVDPVDYTKSALFLAYH 162 >gb|EXX56163.1| hypothetical protein RirG_218640 [Rhizophagus irregularis DAOM 197198w] dbj|GBC30004.1| hypothetical protein RIR_1561200 [Rhizophagus irregularis DAOM 181602] Length = 721 Score = 77.8 bits (190), Expect = 5e-14 Identities = 36/59 (61%), Positives = 44/59 (74%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTFY 224 G+MKL+VY TV YGKSH+LS IACF + G VV+ D QLAV+P DY KSALFL ++ Sbjct: 206 GYMKLFVYGTVGYGKSHILSAIACFLFRTGRRVVFLPDCRQLAVDPVDYTKSALFLAYH 264 >gb|PKK59049.1| hypothetical protein RhiirC2_795395 [Rhizophagus irregularis] Length = 725 Score = 77.8 bits (190), Expect = 5e-14 Identities = 36/59 (61%), Positives = 44/59 (74%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTFY 224 G+MKL+VY TV YGKSH+LS IACF + G VV+ D QLAV+P DY KSALFL ++ Sbjct: 206 GYMKLFVYGTVGYGKSHILSAIACFLFRTGRRVVFLPDCRQLAVDPVDYTKSALFLAYH 264 >gb|EXX67380.1| hypothetical protein RirG_114910 [Rhizophagus irregularis DAOM 197198w] dbj|GBC48332.1| hypothetical protein RIR_3041600 [Rhizophagus irregularis DAOM 181602] Length = 745 Score = 77.8 bits (190), Expect = 5e-14 Identities = 36/59 (61%), Positives = 44/59 (74%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTFY 224 G+MKL+VY TV YGKSH+LS IACF + G VV+ D QLAV+P DY KSALFL ++ Sbjct: 218 GYMKLFVYGTVGYGKSHILSAIACFLFRTGRRVVFLPDCRQLAVDPVDYTKSALFLAYH 276 >gb|POG65016.1| hypothetical protein GLOIN_2v1670108 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 753 Score = 77.8 bits (190), Expect = 5e-14 Identities = 36/59 (61%), Positives = 44/59 (74%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTFY 224 G+MKL+VY TV YGKSH+LS IACF + G VV+ D QLAV+P DY KSALFL ++ Sbjct: 226 GYMKLFVYGTVGYGKSHILSAIACFLFRTGRRVVFLPDCRQLAVDPVDYTKSALFLAYH 284 >gb|POG61805.1| hypothetical protein GLOIN_2v1786107 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 701 Score = 77.0 bits (188), Expect = 1e-13 Identities = 34/58 (58%), Positives = 44/58 (75%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTF 227 G+MKL+VY TV YGKSH+LS IACF + G V++ D QLA++P DY+KSALFL + Sbjct: 220 GYMKLFVYGTVGYGKSHILSAIACFLFRTGKRVIFLPDCRQLALDPVDYVKSALFLAY 277 >gb|PKC57818.1| hypothetical protein RhiirA1_541400 [Rhizophagus irregularis] Length = 727 Score = 77.0 bits (188), Expect = 1e-13 Identities = 34/58 (58%), Positives = 44/58 (75%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTF 227 G+MKL+VY TV YGKSH+LS IACF + G V++ D QLA++P DY+KSALFL + Sbjct: 246 GYMKLFVYGTVGYGKSHILSAIACFLFRTGKRVIFLPDCRQLALDPVDYVKSALFLAY 303 >dbj|GBC28851.1| hypothetical protein RIR_1468300 [Rhizophagus irregularis DAOM 181602] gb|PKY13277.1| hypothetical protein RhiirB3_465295 [Rhizophagus irregularis] Length = 734 Score = 77.0 bits (188), Expect = 1e-13 Identities = 34/58 (58%), Positives = 44/58 (75%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTF 227 G+MKL+VY TV YGKSH+LS IACF + G V++ D QLA++P DY+KSALFL + Sbjct: 253 GYMKLFVYGTVGYGKSHILSAIACFLFRTGKRVIFLPDCRQLALDPVDYVKSALFLAY 310 >gb|PKK56963.1| hypothetical protein RhiirC2_798945 [Rhizophagus irregularis] Length = 547 Score = 73.6 bits (179), Expect = 2e-12 Identities = 35/58 (60%), Positives = 42/58 (72%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTF 227 G+MKL+VY TV YGKSH+LS IACF + G VV+ D QLAV+P YIK AL LT+ Sbjct: 68 GYMKLFVYGTVGYGKSHILSAIACFLFRTGKRVVFLPDCRQLAVDPVKYIKFALLLTY 125 >gb|PKK59642.1| hypothetical protein RhiirC2_820485 [Rhizophagus irregularis] Length = 713 Score = 73.6 bits (179), Expect = 2e-12 Identities = 35/58 (60%), Positives = 42/58 (72%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTF 227 G+MKL+VY TV YGKSH+LS IACF + G VV+ D QLAV+P YIK AL LT+ Sbjct: 234 GYMKLFVYGTVGYGKSHILSAIACFLFRTGKRVVFLPDCRQLAVDPVKYIKFALLLTY 291 >gb|PKC55633.1| hypothetical protein RhiirA1_113727 [Rhizophagus irregularis] gb|PKY30073.1| hypothetical protein RhiirB3_65004 [Rhizophagus irregularis] Length = 255 Score = 72.0 bits (175), Expect = 2e-12 Identities = 28/58 (48%), Positives = 44/58 (75%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTF 227 G+MK ++Y T+ YGKSH+L+ I F ++ G VVY D+++LA++P DY+KSAL+L + Sbjct: 67 GYMKCFIYGTIGYGKSHILATIVWFLLRTGKRVVYLPDFHELAIDPVDYVKSALYLAY 124 >gb|PKK71366.1| hypothetical protein RhiirC2_429356 [Rhizophagus irregularis] Length = 329 Score = 72.0 bits (175), Expect = 3e-12 Identities = 28/58 (48%), Positives = 44/58 (75%) Frame = -3 Query: 400 GFMKLYVYSTVRYGKSHLLSVIACFFIQKGGHVVYFSDYYQLAVNPKDYIKSALFLTF 227 G+MK ++Y T+ YGKSH+L+ I F ++ G VVY D+++LA++P DY+KSAL+L + Sbjct: 67 GYMKCFIYGTIGYGKSHILATIVWFLLRTGKRVVYLPDFHELAIDPVDYVKSALYLAY 124