BLASTX nr result
ID: Ophiopogon27_contig00040976
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00040976 (460 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK64282.1| hypothetical protein RhiirC2_716387 [Rhizophagus ... 59 2e-08 dbj|GBC38999.1| hypothetical protein RIR_2283400 [Rhizophagus ir... 57 4e-08 gb|POG60949.1| hypothetical protein GLOIN_2v1486631 [Rhizophagus... 59 6e-08 >gb|PKK64282.1| hypothetical protein RhiirC2_716387 [Rhizophagus irregularis] Length = 116 Score = 59.3 bits (142), Expect = 2e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -1 Query: 289 RAGYINDASSVNIPALSRNDIRYLEMVFENFLKSINL 179 R GYIND SSVNIPA S NDIRYLE VF+NFLKSINL Sbjct: 55 RVGYINDTSSVNIPAPSGNDIRYLE-VFDNFLKSINL 90 >dbj|GBC38999.1| hypothetical protein RIR_2283400 [Rhizophagus irregularis DAOM 181602] Length = 73 Score = 57.4 bits (137), Expect = 4e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 283 GYINDASSVNIPALSRNDIRYLEMVFENFLKSINL 179 GYIND SSVNIPA S NDIRYLE VF+NFLKSINL Sbjct: 2 GYINDTSSVNIPAPSGNDIRYLE-VFDNFLKSINL 35 >gb|POG60949.1| hypothetical protein GLOIN_2v1486631 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 161 Score = 58.9 bits (141), Expect = 6e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -1 Query: 289 RAGYINDASSVNIPALSRNDIRYLEMVFENFLKSINL 179 R GYIND SSVNIPA S NDIRYLE VF+NFLKSINL Sbjct: 100 RMGYINDTSSVNIPAPSGNDIRYLE-VFDNFLKSINL 135