BLASTX nr result
ID: Ophiopogon27_contig00040934
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00040934 (415 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC58787.1| hypothetical protein RhiirA1_470471 [Rhizophagus ... 48 3e-06 >gb|PKC58787.1| hypothetical protein RhiirA1_470471 [Rhizophagus irregularis] gb|PKY29517.1| hypothetical protein RhiirB3_446173 [Rhizophagus irregularis] Length = 130 Score = 47.8 bits (112), Expect(2) = 3e-06 Identities = 21/41 (51%), Positives = 32/41 (78%) Frame = -3 Query: 161 TSTVIMMNIDGTDIPANFHENLYETLQKLCYIEYESLSAII 39 TS +++M+ DGTDIP N HE+L++ +++ Y EYES SA+I Sbjct: 83 TSDMVIMSSDGTDIPINLHEDLHKIIREWYYNEYESPSALI 123 Score = 30.8 bits (68), Expect(2) = 3e-06 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = -1 Query: 283 TKSALGTIVEDLP*AHYMRLSDKCVAVNNL 194 T+ ALG ++ LP + Y+R+SDK VA+ +L Sbjct: 32 TELALGHFIDKLPQSRYIRVSDKYVAICHL 61