BLASTX nr result
ID: Ophiopogon27_contig00040142
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00040142 (435 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY19195.1| hypothetical protein RhiirB3_406553 [Rhizophagus ... 120 5e-33 dbj|GBC47561.1| hypothetical protein RIR_2976700 [Rhizophagus ir... 120 7e-33 >gb|PKY19195.1| hypothetical protein RhiirB3_406553 [Rhizophagus irregularis] Length = 61 Score = 120 bits (300), Expect = 5e-33 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 1/59 (1%) Frame = -2 Query: 371 MFSLSGRFSSFLKLS-FKPNLFLQVRHDSSLDKFYRPRKTHYPPPKPRDKTARYDGFLK 198 MFSLSGRFSSFLKLS FKPNLFLQVRHDSSLDKFYRPRKTHYPPPKPRDKTARYDGFLK Sbjct: 1 MFSLSGRFSSFLKLSSFKPNLFLQVRHDSSLDKFYRPRKTHYPPPKPRDKTARYDGFLK 59 >dbj|GBC47561.1| hypothetical protein RIR_2976700 [Rhizophagus irregularis DAOM 181602] Length = 71 Score = 120 bits (300), Expect = 7e-33 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 1/59 (1%) Frame = -2 Query: 371 MFSLSGRFSSFLKLS-FKPNLFLQVRHDSSLDKFYRPRKTHYPPPKPRDKTARYDGFLK 198 MFSLSGRFSSFLKLS FKPNLFLQVRHDSSLDKFYRPRKTHYPPPKPRDKTARYDGFLK Sbjct: 1 MFSLSGRFSSFLKLSSFKPNLFLQVRHDSSLDKFYRPRKTHYPPPKPRDKTARYDGFLK 59