BLASTX nr result
ID: Ophiopogon27_contig00040069
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00040069 (461 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX62722.1| hypothetical protein RirG_159040 [Rhizophagus irr... 62 3e-08 dbj|GBC51527.1| hypothetical protein RIR_3303700 [Rhizophagus ir... 62 4e-08 gb|POG75804.1| hypothetical protein GLOIN_2v1838532 [Rhizophagus... 57 2e-06 dbj|GBC51526.1| hypothetical protein RIR_3303700 [Rhizophagus ir... 57 2e-06 dbj|GBC51528.1| hypothetical protein RIR_3303700 [Rhizophagus ir... 57 2e-06 >gb|EXX62722.1| hypothetical protein RirG_159040 [Rhizophagus irregularis DAOM 197198w] Length = 334 Score = 61.6 bits (148), Expect = 3e-08 Identities = 33/78 (42%), Positives = 46/78 (58%), Gaps = 2/78 (2%) Frame = -3 Query: 399 MKSETSNRSLSLYWDEMIRERKELKVENIHINGSLDLLSKVGRHNIRKL--ESKYPEKTK 226 +++E NR L LYWDE++RER++ V IHI GSL LL GR NI++L + K Sbjct: 74 VEAECRNRGLKLYWDEILREREKNNVREIHITGSLKLLGASGRRNIQELLTDGTILPKQD 133 Query: 225 EDDHEESREKWTKIDDEN 172 DD + E ++DEN Sbjct: 134 MDDLPKVEEGVNDVEDEN 151 >dbj|GBC51527.1| hypothetical protein RIR_3303700 [Rhizophagus irregularis DAOM 181602] Length = 512 Score = 61.6 bits (148), Expect = 4e-08 Identities = 33/78 (42%), Positives = 46/78 (58%), Gaps = 2/78 (2%) Frame = -3 Query: 399 MKSETSNRSLSLYWDEMIRERKELKVENIHINGSLDLLSKVGRHNIRKL--ESKYPEKTK 226 +++E NR L LYWDE++RER++ V IHI GSL LL GR NI++L + K Sbjct: 74 VEAECRNRGLKLYWDEILREREKNNVREIHITGSLKLLGASGRRNIQELLTDGTILPKQD 133 Query: 225 EDDHEESREKWTKIDDEN 172 DD + E ++DEN Sbjct: 134 MDDLPKVEEGVNDVEDEN 151 >gb|POG75804.1| hypothetical protein GLOIN_2v1838532 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 511 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = -3 Query: 399 MKSETSNRSLSLYWDEMIRERKELKVENIHINGSLDLLSKVGRHNIRKL 253 +++E NR L LYWDE++RER++ V IHI GSL LL GR NI++L Sbjct: 74 VEAECRNRGLKLYWDEILREREKNNVREIHITGSLKLLGASGRRNIQEL 122 >dbj|GBC51526.1| hypothetical protein RIR_3303700 [Rhizophagus irregularis DAOM 181602] Length = 521 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = -3 Query: 399 MKSETSNRSLSLYWDEMIRERKELKVENIHINGSLDLLSKVGRHNIRKL 253 +++E NR L LYWDE++RER++ V IHI GSL LL GR NI++L Sbjct: 74 VEAECRNRGLKLYWDEILREREKNNVREIHITGSLKLLGASGRRNIQEL 122 >dbj|GBC51528.1| hypothetical protein RIR_3303700 [Rhizophagus irregularis DAOM 181602] Length = 522 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = -3 Query: 399 MKSETSNRSLSLYWDEMIRERKELKVENIHINGSLDLLSKVGRHNIRKL 253 +++E NR L LYWDE++RER++ V IHI GSL LL GR NI++L Sbjct: 74 VEAECRNRGLKLYWDEILREREKNNVREIHITGSLKLLGASGRRNIQEL 122