BLASTX nr result
ID: Ophiopogon27_contig00039864
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00039864 (484 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY17551.1| RNA-binding domain-containing protein [Rhizophagu... 57 2e-07 gb|PKY41172.1| RNA-binding domain-containing protein [Rhizophagu... 57 2e-07 gb|PKC14366.1| RNA-binding domain-containing protein [Rhizophagu... 57 2e-07 dbj|GBC26269.1| glycine-rich RNA-binding protein 2 [Rhizophagus ... 57 1e-06 >gb|PKY17551.1| RNA-binding domain-containing protein [Rhizophagus irregularis] Length = 128 Score = 57.4 bits (137), Expect = 2e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 483 EDAENAIENLNDSEFDGRTIKVDRAAERSPPAP 385 E+AE AI+NLND+EFDGR IKVDRAAERS PAP Sbjct: 55 EEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAP 87 >gb|PKY41172.1| RNA-binding domain-containing protein [Rhizophagus irregularis] Length = 133 Score = 57.4 bits (137), Expect = 2e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 483 EDAENAIENLNDSEFDGRTIKVDRAAERSPPAP 385 E+AE AI+NLND+EFDGR IKVDRAAERS PAP Sbjct: 55 EEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAP 87 >gb|PKC14366.1| RNA-binding domain-containing protein [Rhizophagus irregularis] gb|PKC70041.1| RNA-binding domain-containing protein [Rhizophagus irregularis] gb|PKK73911.1| RNA-binding domain-containing protein [Rhizophagus irregularis] gb|POG68613.1| hypothetical protein GLOIN_2v1635358 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 134 Score = 57.4 bits (137), Expect = 2e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 483 EDAENAIENLNDSEFDGRTIKVDRAAERSPPAP 385 E+AE AI+NLND+EFDGR IKVDRAAERS PAP Sbjct: 55 EEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAP 87 >dbj|GBC26269.1| glycine-rich RNA-binding protein 2 [Rhizophagus irregularis DAOM 181602] Length = 319 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 483 EDAENAIENLNDSEFDGRTIKVDRAAERSPPAP 385 E+AE AI+NLND+EFDGR IKVDRAAERS PAP Sbjct: 240 EEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAP 272