BLASTX nr result
ID: Ophiopogon27_contig00039527
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00039527 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020183132.1| putative pentatricopeptide repeat-containing... 59 3e-07 ref|XP_010235976.2| PREDICTED: disease resistance protein RPM1 [... 59 3e-07 ref|XP_010911247.1| PREDICTED: putative pentatricopeptide repeat... 59 3e-07 ref|XP_008792712.1| PREDICTED: putative pentatricopeptide repeat... 59 4e-07 gb|PKU79009.1| Putative pentatricopeptide repeat-containing prot... 59 5e-07 ref|XP_020702410.1| putative pentatricopeptide repeat-containing... 59 5e-07 gb|PKU79010.1| Putative pentatricopeptide repeat-containing prot... 59 5e-07 dbj|BAJ98195.1| predicted protein [Hordeum vulgare subsp. vulgare] 58 9e-07 emb|CBI27286.3| unnamed protein product, partial [Vitis vinifera] 57 1e-06 ref|XP_002274259.1| PREDICTED: putative pentatricopeptide repeat... 57 1e-06 gb|KQK15394.2| hypothetical protein BRADI_1g22490v3 [Brachypodiu... 57 2e-06 gb|OVA18894.1| Pentatricopeptide repeat [Macleaya cordata] 56 3e-06 ref|XP_020103714.1| putative pentatricopeptide repeat-containing... 56 3e-06 gb|OAY72752.1| putative pentatricopeptide repeat-containing prot... 56 3e-06 gb|ERM99976.1| hypothetical protein AMTR_s00110p00125440 [Ambore... 56 4e-06 ref|XP_020599343.1| putative pentatricopeptide repeat-containing... 56 4e-06 ref|XP_011621105.1| putative pentatricopeptide repeat-containing... 56 4e-06 ref|XP_015694712.1| PREDICTED: putative pentatricopeptide repeat... 56 4e-06 ref|XP_022131400.1| putative pentatricopeptide repeat-containing... 56 4e-06 ref|XP_010258086.1| PREDICTED: putative pentatricopeptide repeat... 56 4e-06 >ref|XP_020183132.1| putative pentatricopeptide repeat-containing protein At1g26500 [Aegilops tauschii subsp. tauschii] Length = 519 Score = 59.3 bits (142), Expect = 3e-07 Identities = 32/69 (46%), Positives = 36/69 (52%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGRRXXXXXXXXXXXXXXXYGXXXXXXXXXXXXK 180 V+VPRFDYN+FLH FSNEEGVAMF+EVGRR YG Sbjct: 436 VDVPRFDYNKFLHYFSNEEGVAMFEEVGRRLRETGHVDLGDIFLTYGERMATRDRRRRAM 495 Query: 181 VGYLETMED 207 G L +ED Sbjct: 496 NGRLTAVED 504 >ref|XP_010235976.2| PREDICTED: disease resistance protein RPM1 [Brachypodium distachyon] Length = 1494 Score = 59.3 bits (142), Expect = 3e-07 Identities = 32/71 (45%), Positives = 37/71 (52%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGRRXXXXXXXXXXXXXXXYGXXXXXXXXXXXXK 180 V+VPRFDYN+FLH FSNEEGV MF+EVGRR YG Sbjct: 470 VDVPRFDYNKFLHYFSNEEGVPMFEEVGRRLREVGLVDLGDILLIYGERMATRDRRREAM 529 Query: 181 VGYLETMEDSM 213 G L MED++ Sbjct: 530 RGRLTEMEDAV 540 >ref|XP_010911247.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g26500 [Elaeis guineensis] Length = 496 Score = 58.9 bits (141), Expect = 3e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGRR 90 VEVPRFDYN+FLH FSNEEGVAMF+EVG+R Sbjct: 431 VEVPRFDYNKFLHWFSNEEGVAMFEEVGKR 460 >ref|XP_008792712.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g26500 [Phoenix dactylifera] Length = 502 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGRR 90 VEVPRFDYN+FLH FSNEEGVAMF+EVG+R Sbjct: 437 VEVPRFDYNKFLHWFSNEEGVAMFEEVGKR 466 >gb|PKU79009.1| Putative pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 446 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGRR 90 VEVPRFDYN+FLH FSNEEGV MF+EVGRR Sbjct: 125 VEVPRFDYNKFLHLFSNEEGVEMFQEVGRR 154 >ref|XP_020702410.1| putative pentatricopeptide repeat-containing protein At1g26500, partial [Dendrobium catenatum] Length = 505 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGRR 90 VEVPRFDYN+FLH FSNEEGV MF+EVGRR Sbjct: 434 VEVPRFDYNKFLHLFSNEEGVEMFQEVGRR 463 >gb|PKU79010.1| Putative pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 560 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGRR 90 VEVPRFDYN+FLH FSNEEGV MF+EVGRR Sbjct: 489 VEVPRFDYNKFLHLFSNEEGVEMFQEVGRR 518 >dbj|BAJ98195.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 513 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGRR 90 V+VPRFDYN+FLH FSN+EGVAMF+EVGRR Sbjct: 430 VDVPRFDYNKFLHYFSNDEGVAMFEEVGRR 459 >emb|CBI27286.3| unnamed protein product, partial [Vitis vinifera] Length = 523 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGRR 90 +EVPRFDYN+FLHC+SNEEGV MF+EVG++ Sbjct: 433 MEVPRFDYNRFLHCYSNEEGVFMFEEVGKK 462 >ref|XP_002274259.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g26500 [Vitis vinifera] Length = 525 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGRR 90 +EVPRFDYN+FLHC+SNEEGV MF+EVG++ Sbjct: 435 MEVPRFDYNRFLHCYSNEEGVFMFEEVGKK 464 >gb|KQK15394.2| hypothetical protein BRADI_1g22490v3 [Brachypodium distachyon] Length = 545 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGRR 90 V+VPRFDYN+FLH FSNEEGV MF+EVGRR Sbjct: 437 VDVPRFDYNKFLHYFSNEEGVPMFEEVGRR 466 >gb|OVA18894.1| Pentatricopeptide repeat [Macleaya cordata] Length = 380 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGRR 90 +EVPRFDYN+FLH FSNEEG+ MF+EVG+R Sbjct: 319 IEVPRFDYNKFLHDFSNEEGIVMFEEVGKR 348 >ref|XP_020103714.1| putative pentatricopeptide repeat-containing protein At1g26500 [Ananas comosus] Length = 456 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGRR 90 VEVPRFDYN+FL+ FSNEEGV MF+EVGRR Sbjct: 393 VEVPRFDYNKFLYYFSNEEGVVMFEEVGRR 422 >gb|OAY72752.1| putative pentatricopeptide repeat-containing protein [Ananas comosus] Length = 527 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGRR 90 VEVPRFDYN+FL+ FSNEEGV MF+EVGRR Sbjct: 464 VEVPRFDYNKFLYYFSNEEGVVMFEEVGRR 493 >gb|ERM99976.1| hypothetical protein AMTR_s00110p00125440 [Amborella trichopoda] Length = 468 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGR 87 VEVPRFDYN+FLH FSNEEGV MF+EVG+ Sbjct: 405 VEVPRFDYNKFLHAFSNEEGVKMFEEVGK 433 >ref|XP_020599343.1| putative pentatricopeptide repeat-containing protein At1g26500 [Phalaenopsis equestris] Length = 470 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGRR 90 VEVPRFDYN+FLH FSNEEGV MF+ VGRR Sbjct: 406 VEVPRFDYNKFLHLFSNEEGVEMFQVVGRR 435 >ref|XP_011621105.1| putative pentatricopeptide repeat-containing protein At1g26500 [Amborella trichopoda] Length = 491 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGR 87 VEVPRFDYN+FLH FSNEEGV MF+EVG+ Sbjct: 428 VEVPRFDYNKFLHAFSNEEGVKMFEEVGK 456 >ref|XP_015694712.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g26500 [Oryza brachyantha] Length = 502 Score = 55.8 bits (133), Expect = 4e-06 Identities = 29/69 (42%), Positives = 37/69 (53%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGRRXXXXXXXXXXXXXXXYGXXXXXXXXXXXXK 180 V+VPRFDYN+FL+ FSNEEGV+MF+EVGRR YG Sbjct: 432 VDVPRFDYNKFLYYFSNEEGVSMFEEVGRRLKDVGHVDLGDIFLTYGERMATRDRRRRAM 491 Query: 181 VGYLETMED 207 G+L ++D Sbjct: 492 NGHLTEVQD 500 >ref|XP_022131400.1| putative pentatricopeptide repeat-containing protein At1g26500 [Momordica charantia] Length = 506 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGRR 90 VEVPRFDYN+FLH +SNEEGV MF+EVG R Sbjct: 441 VEVPRFDYNKFLHYYSNEEGVVMFREVGNR 470 >ref|XP_010258086.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g26500 [Nelumbo nucifera] Length = 519 Score = 55.8 bits (133), Expect = 4e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +1 Query: 1 VEVPRFDYNQFLHCFSNEEGVAMFKEVGRR 90 V+VPRFDYN+FL+CFSNEEG+ F+EVG+R Sbjct: 438 VDVPRFDYNKFLYCFSNEEGIVFFEEVGKR 467