BLASTX nr result
ID: Ophiopogon27_contig00039427
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00039427 (427 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020262956.1| uncharacterized protein LOC109838931 [Aspara... 55 8e-06 >ref|XP_020262956.1| uncharacterized protein LOC109838931 [Asparagus officinalis] Length = 559 Score = 54.7 bits (130), Expect = 8e-06 Identities = 33/57 (57%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = -2 Query: 168 YNCKKKGHIGKNCKQYKE-LFKENGPTSNDGTKKNGDHIGVVEDLKDSCDVLTAESG 1 Y CK+ GH KNCK YKE L KE+G T D TK +H VVEDL +VLTAESG Sbjct: 495 YTCKRPGHFKKNCKLYKEYLKKEDGET--DNTKGKDNHACVVEDL---YEVLTAESG 546