BLASTX nr result
ID: Ophiopogon27_contig00039415
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00039415 (413 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020267190.1| receptor protein kinase-like protein ZAR1 [A... 77 8e-14 gb|ONK68180.1| uncharacterized protein A4U43_C05F8460 [Asparagus... 77 8e-14 ref|XP_020099066.1| receptor protein kinase-like protein ZAR1 [A... 74 1e-12 gb|OAY68911.1| putative inactive leucine-rich repeat receptor-li... 74 1e-12 ref|XP_016438099.1| PREDICTED: probable inactive leucine-rich re... 74 2e-12 ref|XP_009801886.1| PREDICTED: probable inactive leucine-rich re... 74 2e-12 ref|XP_010262185.1| PREDICTED: receptor protein kinase-like prot... 73 2e-12 gb|PON86989.1| Serine/threonine protein kinase [Trema orientalis] 73 3e-12 gb|PON64504.1| Serine/threonine protein kinase [Parasponia ander... 73 3e-12 ref|XP_016557184.1| PREDICTED: probable inactive leucine-rich re... 72 4e-12 gb|PRQ40285.1| putative protein kinase RLK-Pelle-LRR-III family ... 72 4e-12 ref|XP_010922469.1| PREDICTED: receptor protein kinase-like prot... 72 5e-12 ref|XP_008810049.1| PREDICTED: receptor protein kinase-like prot... 72 5e-12 ref|XP_024197412.1| receptor protein kinase-like protein ZAR1 [R... 72 5e-12 ref|XP_004299037.1| PREDICTED: probable inactive leucine-rich re... 72 5e-12 ref|XP_010101692.2| receptor protein kinase-like protein ZAR1, p... 72 6e-12 ref|XP_016476832.1| PREDICTED: probable inactive leucine-rich re... 72 6e-12 gb|OEL20291.1| Receptor protein kinase-like protein ZAR1 [Dichan... 72 6e-12 ref|XP_004968837.1| receptor protein kinase-like protein ZAR1 [S... 72 6e-12 gb|PAN30935.1| hypothetical protein PAHAL_J01270 [Panicum hallii] 72 6e-12 >ref|XP_020267190.1| receptor protein kinase-like protein ZAR1 [Asparagus officinalis] Length = 685 Score = 77.4 bits (189), Expect = 8e-14 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 306 V+HQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH Sbjct: 447 VKHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 482 >gb|ONK68180.1| uncharacterized protein A4U43_C05F8460 [Asparagus officinalis] Length = 703 Score = 77.4 bits (189), Expect = 8e-14 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 306 V+HQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH Sbjct: 447 VKHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 482 >ref|XP_020099066.1| receptor protein kinase-like protein ZAR1 [Ananas comosus] Length = 717 Score = 73.9 bits (180), Expect = 1e-12 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 306 VRH NIVTLRAYYWS+DEKLLIYDYIPNGNL+AA+H Sbjct: 466 VRHPNIVTLRAYYWSVDEKLLIYDYIPNGNLTAAIH 501 >gb|OAY68911.1| putative inactive leucine-rich repeat receptor-like protein kinase [Ananas comosus] Length = 717 Score = 73.9 bits (180), Expect = 1e-12 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 306 VRH NIVTLRAYYWS+DEKLLIYDYIPNGNL+AA+H Sbjct: 466 VRHPNIVTLRAYYWSVDEKLLIYDYIPNGNLTAAIH 501 >ref|XP_016438099.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At1g66830 isoform X2 [Nicotiana tabacum] Length = 713 Score = 73.6 bits (179), Expect = 2e-12 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALHVLKEM 291 +RHQNIVTLRAYYWS+DEKLLIYD+IPNGNL+ A+H EM Sbjct: 454 LRHQNIVTLRAYYWSVDEKLLIYDFIPNGNLATAIHGKPEM 494 >ref|XP_009801886.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At1g66830 [Nicotiana sylvestris] ref|XP_016438098.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At1g66830 isoform X1 [Nicotiana tabacum] Length = 713 Score = 73.6 bits (179), Expect = 2e-12 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALHVLKEM 291 +RHQNIVTLRAYYWS+DEKLLIYD+IPNGNL+ A+H EM Sbjct: 454 LRHQNIVTLRAYYWSVDEKLLIYDFIPNGNLATAIHGKPEM 494 >ref|XP_010262185.1| PREDICTED: receptor protein kinase-like protein ZAR1 [Nelumbo nucifera] Length = 713 Score = 73.2 bits (178), Expect = 2e-12 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 306 +RH NIVTLRAYYWSIDEKLLIYDYIPNGNLS ALH Sbjct: 457 LRHLNIVTLRAYYWSIDEKLLIYDYIPNGNLSTALH 492 >gb|PON86989.1| Serine/threonine protein kinase [Trema orientalis] Length = 714 Score = 72.8 bits (177), Expect = 3e-12 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 306 +RH NIVTLRAYYWS+DEKLLIYDY+PNGNLS ALH Sbjct: 455 LRHPNIVTLRAYYWSVDEKLLIYDYVPNGNLSTALH 490 >gb|PON64504.1| Serine/threonine protein kinase [Parasponia andersonii] Length = 714 Score = 72.8 bits (177), Expect = 3e-12 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 306 +RH N+VTLRAYYWS+DEKLLIYDYIPNGNLS ALH Sbjct: 455 LRHPNVVTLRAYYWSVDEKLLIYDYIPNGNLSTALH 490 >ref|XP_016557184.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At1g66830 [Capsicum annuum] Length = 326 Score = 72.0 bits (175), Expect = 4e-12 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 306 +RHQNIVTLRAYYWS+DEKLLIYD+IPNGNL+ A+H Sbjct: 68 LRHQNIVTLRAYYWSVDEKLLIYDFIPNGNLATAIH 103 >gb|PRQ40285.1| putative protein kinase RLK-Pelle-LRR-III family [Rosa chinensis] Length = 458 Score = 72.4 bits (176), Expect = 4e-12 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 306 +RH NIVTLRAYYWS+DEKLLIYDY+PNGNL+AA+H Sbjct: 199 LRHPNIVTLRAYYWSVDEKLLIYDYVPNGNLAAAIH 234 >ref|XP_010922469.1| PREDICTED: receptor protein kinase-like protein ZAR1 [Elaeis guineensis] Length = 712 Score = 72.4 bits (176), Expect = 5e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 306 VRH NIVTLRAYYWS DEKLLIYDYIPNGNL+AA+H Sbjct: 459 VRHPNIVTLRAYYWSADEKLLIYDYIPNGNLTAAIH 494 >ref|XP_008810049.1| PREDICTED: receptor protein kinase-like protein ZAR1 [Phoenix dactylifera] Length = 712 Score = 72.4 bits (176), Expect = 5e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 306 VRH NIVTLRAYYWS DEKLLIYDYIPNGNL+AA+H Sbjct: 459 VRHPNIVTLRAYYWSADEKLLIYDYIPNGNLTAAIH 494 >ref|XP_024197412.1| receptor protein kinase-like protein ZAR1 [Rosa chinensis] Length = 714 Score = 72.4 bits (176), Expect = 5e-12 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 306 +RH NIVTLRAYYWS+DEKLLIYDY+PNGNL+AA+H Sbjct: 455 LRHPNIVTLRAYYWSVDEKLLIYDYVPNGNLAAAIH 490 >ref|XP_004299037.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At1g66830 [Fragaria vesca subsp. vesca] Length = 714 Score = 72.4 bits (176), Expect = 5e-12 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 306 +RH NIVTLRAYYWS+DEKLLIYDY+PNGNL+AA+H Sbjct: 455 LRHPNIVTLRAYYWSVDEKLLIYDYVPNGNLAAAIH 490 >ref|XP_010101692.2| receptor protein kinase-like protein ZAR1, partial [Morus notabilis] Length = 454 Score = 72.0 bits (175), Expect = 6e-12 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 306 +RH NIVTLRAYYWS+DEKLLIYDYIPNGNLS A+H Sbjct: 196 LRHPNIVTLRAYYWSVDEKLLIYDYIPNGNLSTAVH 231 >ref|XP_016476832.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At1g66830, partial [Nicotiana tabacum] Length = 612 Score = 72.0 bits (175), Expect = 6e-12 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 306 +RHQNIVTLRAYYWS+DEKLLIYD+IPNGNL+ A+H Sbjct: 454 LRHQNIVTLRAYYWSVDEKLLIYDFIPNGNLATAIH 489 >gb|OEL20291.1| Receptor protein kinase-like protein ZAR1 [Dichanthelium oligosanthes] Length = 709 Score = 72.0 bits (175), Expect = 6e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 306 VRH NIVTLRAYYWS DEKLLIYDYIPNG+LSAA+H Sbjct: 458 VRHPNIVTLRAYYWSFDEKLLIYDYIPNGSLSAAIH 493 >ref|XP_004968837.1| receptor protein kinase-like protein ZAR1 [Setaria italica] gb|KQL05325.1| hypothetical protein SETIT_000489mg [Setaria italica] Length = 709 Score = 72.0 bits (175), Expect = 6e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 306 VRH NIVTLRAYYWS DEKLLIYDYIPNG+LSAA+H Sbjct: 458 VRHPNIVTLRAYYWSFDEKLLIYDYIPNGSLSAAIH 493 >gb|PAN30935.1| hypothetical protein PAHAL_J01270 [Panicum hallii] Length = 710 Score = 72.0 bits (175), Expect = 6e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 413 VRHQNIVTLRAYYWSIDEKLLIYDYIPNGNLSAALH 306 VRH NIVTLRAYYWS DEKLLIYDY+PNG+LSAALH Sbjct: 459 VRHPNIVTLRAYYWSFDEKLLIYDYLPNGSLSAALH 494