BLASTX nr result
ID: Ophiopogon27_contig00039066
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00039066 (593 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK59415.1| uncharacterized protein A4U43_C08F6200 [Asparagus... 87 3e-16 ref|XP_020277121.1| pentatricopeptide repeat-containing protein ... 87 3e-16 >gb|ONK59415.1| uncharacterized protein A4U43_C08F6200 [Asparagus officinalis] Length = 601 Score = 86.7 bits (213), Expect = 3e-16 Identities = 44/65 (67%), Positives = 52/65 (80%) Frame = -1 Query: 590 VYSLSKHAPVKFEVMQVEGIIPEHVILLLIFSDVSNIGLVDERFNSVSSLHRSEIDNSHR 411 +YSLS +A VKFEVMQVEGIIPEHVILLL+FSDVS GL DE F+S+S+L RS ++ R Sbjct: 537 LYSLSTYASVKFEVMQVEGIIPEHVILLLVFSDVSRFGLFDETFSSISALRRSGFSSNQR 596 Query: 410 LSAWA 396 SA A Sbjct: 597 ASALA 601 >ref|XP_020277121.1| pentatricopeptide repeat-containing protein At4g18520-like [Asparagus officinalis] ref|XP_020277122.1| pentatricopeptide repeat-containing protein At4g18520-like [Asparagus officinalis] ref|XP_020277123.1| pentatricopeptide repeat-containing protein At4g18520-like [Asparagus officinalis] ref|XP_020277125.1| pentatricopeptide repeat-containing protein At4g18520-like [Asparagus officinalis] Length = 884 Score = 86.7 bits (213), Expect = 3e-16 Identities = 44/65 (67%), Positives = 52/65 (80%) Frame = -1 Query: 590 VYSLSKHAPVKFEVMQVEGIIPEHVILLLIFSDVSNIGLVDERFNSVSSLHRSEIDNSHR 411 +YSLS +A VKFEVMQVEGIIPEHVILLL+FSDVS GL DE F+S+S+L RS ++ R Sbjct: 820 LYSLSTYASVKFEVMQVEGIIPEHVILLLVFSDVSRFGLFDETFSSISALRRSGFSSNQR 879 Query: 410 LSAWA 396 SA A Sbjct: 880 ASALA 884