BLASTX nr result
ID: Ophiopogon27_contig00038993
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00038993 (525 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY39274.1| hypothetical protein RhiirA4_213973 [Rhizophagus ... 61 6e-10 >gb|PKY39274.1| hypothetical protein RhiirA4_213973 [Rhizophagus irregularis] Length = 66 Score = 61.2 bits (147), Expect(2) = 6e-10 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = -1 Query: 366 QSIRKTLTFRSDQHNDIF*RSTWSAIKMLYHIIVRNVVKDYPL 238 +SIRKTLTF SDQHNDIF + K LYHIIVRNVVKDY L Sbjct: 5 ESIRKTLTFHSDQHNDIFCKIHLEHHKKLYHIIVRNVVKDYSL 47 Score = 30.0 bits (66), Expect(2) = 6e-10 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 239 CGILSYVFFLLSS 201 CGILSYVFFLLSS Sbjct: 48 CGILSYVFFLLSS 60