BLASTX nr result
ID: Ophiopogon27_contig00038680
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00038680 (505 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK57668.1| uncharacterized protein A4U43_C09F2850 [Asparagus... 56 2e-06 >gb|ONK57668.1| uncharacterized protein A4U43_C09F2850 [Asparagus officinalis] Length = 229 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/71 (32%), Positives = 46/71 (64%), Gaps = 1/71 (1%) Frame = +1 Query: 154 IIVAATIPVMDVKINKVELAV-WNALSWLNQKSG*AFLWLEGDSKWTINQLNNTIFTSED 330 I+ A IP+ +K+N EL V W+AL+W ++ G +W+ GDSK ++ L+ + ++ Sbjct: 102 ILAATAIPIDHIKVNYAELIVAWSALTWCYKRYGACLVWIAGDSKHVLDLLSKEPYHTDS 161 Query: 331 PIVTDCRALMN 363 PI+ +C+++++ Sbjct: 162 PILVNCKSIIS 172