BLASTX nr result
ID: Ophiopogon27_contig00038576
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00038576 (459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252816.1| PLASMODESMATA CALLOSE-BINDING PROTEIN 2-like... 65 5e-10 >ref|XP_020252816.1| PLASMODESMATA CALLOSE-BINDING PROTEIN 2-like [Asparagus officinalis] Length = 211 Score = 65.5 bits (158), Expect = 5e-10 Identities = 32/49 (65%), Positives = 38/49 (77%), Gaps = 2/49 (4%) Frame = -1 Query: 357 PSNGLTPGNGLTPSTGIN-GFGPTVPNT-DMSGASAILLPLTLFACSYF 217 P GLTPGNGLTP+TG N GF PT+PNT D+SGA ++ LPL LF C +F Sbjct: 157 PVGGLTPGNGLTPNTGFNSGFSPTLPNTDDISGACSVPLPLLLFTCFHF 205