BLASTX nr result
ID: Ophiopogon27_contig00038572
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00038572 (450 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK64342.1| uncharacterized protein A4U43_C07F24700 [Asparagu... 55 2e-06 ref|XP_020275692.1| RNA-binding protein 24 [Asparagus officinali... 55 3e-06 >gb|ONK64342.1| uncharacterized protein A4U43_C07F24700 [Asparagus officinalis] Length = 195 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 73 FGLHYHPQMLQYPYLSQQFGSAGSSTILSLPAASVA 180 FGLHY PQMLQYPYL QQFGS S+ ILSLPA++ A Sbjct: 141 FGLHY-PQMLQYPYLPQQFGSGSSTPILSLPASNAA 175 >ref|XP_020275692.1| RNA-binding protein 24 [Asparagus officinalis] ref|XP_020275693.1| RNA-binding protein 24 [Asparagus officinalis] Length = 264 Score = 55.5 bits (132), Expect = 3e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 73 FGLHYHPQMLQYPYLSQQFGSAGSSTILSLPAASVA 180 FGLHY PQMLQYPYL QQFGS S+ ILSLPA++ A Sbjct: 210 FGLHY-PQMLQYPYLPQQFGSGSSTPILSLPASNAA 244