BLASTX nr result
ID: Ophiopogon27_contig00038509
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00038509 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022146522.1| FACT complex subunit SPT16-like [Momordica c... 54 8e-06 >ref|XP_022146522.1| FACT complex subunit SPT16-like [Momordica charantia] Length = 1074 Score = 53.9 bits (128), Expect = 8e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +2 Query: 125 FIEDGGWKFLNIEGNDSES*AYEASD*GY*LSNVEPKTDLGED 253 FI+DGGW+FLN+E DSES E SD GY S+VEP++D ED Sbjct: 952 FIDDGGWEFLNLEATDSESDNSEESDKGYVPSDVEPESDSEED 994