BLASTX nr result
ID: Ophiopogon27_contig00038124
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00038124 (414 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275515.1| putative calcium-binding protein CML19 [Aspa... 35 7e-06 >ref|XP_020275515.1| putative calcium-binding protein CML19 [Asparagus officinalis] gb|ONK65361.1| uncharacterized protein A4U43_C07F36320 [Asparagus officinalis] Length = 137 Score = 35.0 bits (79), Expect(4) = 7e-06 Identities = 19/39 (48%), Positives = 25/39 (64%) Frame = -2 Query: 290 KEKREALGMYKMEMEGEGCVTAKSLKRMLIEPTGKLDLQ 174 KE REA MY M+ GE C+TA+SL RML +D++ Sbjct: 73 KELREAFKMYGMD--GEDCITAESLMRMLARLGNVVDVE 109 Score = 33.5 bits (75), Expect(4) = 7e-06 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = -1 Query: 357 VDSNGDGLLEPK*LINKLMADVEGEE 280 +DSNGDGLLE + L+ LM + EGE+ Sbjct: 47 IDSNGDGLLELEELVKMLMENEEGED 72 Score = 26.2 bits (56), Expect(4) = 7e-06 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 181 ICRFDLDGDMECSASKLQLFL 119 ICRFDLDGD S + +L + Sbjct: 115 ICRFDLDGDGVISFDEFRLMM 135 Score = 20.8 bits (42), Expect(4) = 7e-06 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -3 Query: 412 AIGEELSREDA 380 +IGEELS EDA Sbjct: 30 SIGEELSYEDA 40