BLASTX nr result
ID: Ophiopogon27_contig00038007
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00038007 (400 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK71489.1| uncharacterized protein A4U43_C04F9180 [Asparagus... 66 6e-10 ref|XP_020262391.1| LOW QUALITY PROTEIN: DNA topoisomerase 2-lik... 66 6e-10 >gb|ONK71489.1| uncharacterized protein A4U43_C04F9180 [Asparagus officinalis] Length = 1419 Score = 66.2 bits (160), Expect = 6e-10 Identities = 35/53 (66%), Positives = 38/53 (71%) Frame = -3 Query: 398 KSGSVLGRARGPVVESEGSIDSSPSVNLEVEMNEVPVARNRPKRENRSKVQYV 240 KSGSVLGRA G + ESEGS+ S SVNLE + V V RN PKRENR KV YV Sbjct: 1342 KSGSVLGRAGGSMTESEGSVGSLSSVNLEAGRDVVQVTRNLPKRENRKKVTYV 1394 >ref|XP_020262391.1| LOW QUALITY PROTEIN: DNA topoisomerase 2-like [Asparagus officinalis] Length = 1489 Score = 66.2 bits (160), Expect = 6e-10 Identities = 35/53 (66%), Positives = 38/53 (71%) Frame = -3 Query: 398 KSGSVLGRARGPVVESEGSIDSSPSVNLEVEMNEVPVARNRPKRENRSKVQYV 240 KSGSVLGRA G + ESEGS+ S SVNLE + V V RN PKRENR KV YV Sbjct: 1412 KSGSVLGRAGGSMTESEGSVGSLSSVNLEAGRDVVQVTRNLPKRENRKKVTYV 1464