BLASTX nr result
ID: Ophiopogon27_contig00037943
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00037943 (407 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC02690.1| hypothetical protein RhiirA5_503890 [Rhizophagus ... 91 2e-21 gb|PKY52509.1| hypothetical protein RhiirA4_470178 [Rhizophagus ... 89 7e-21 dbj|GBC13850.1| hypothetical protein RIR_0250400 [Rhizophagus ir... 89 1e-20 gb|PKY24578.1| hypothetical protein RhiirB3_527321 [Rhizophagus ... 88 2e-20 gb|EXX59798.1| hypothetical protein RirG_185810 [Rhizophagus irr... 88 2e-20 gb|PKC03008.1| hypothetical protein RhiirA5_424398 [Rhizophagus ... 87 5e-20 gb|PKC54110.1| hypothetical protein RhiirA1_477944 [Rhizophagus ... 87 6e-20 gb|PKY44991.1| hypothetical protein RhiirA4_459460 [Rhizophagus ... 87 8e-20 gb|PKK63949.1| hypothetical protein RhiirC2_854672 [Rhizophagus ... 86 1e-19 gb|POG66268.1| hypothetical protein GLOIN_2v1780765 [Rhizophagus... 86 1e-19 gb|PKC09693.1| hypothetical protein RhiirA5_415315 [Rhizophagus ... 84 1e-18 dbj|GBC33313.1| hypothetical protein RIR_1824600 [Rhizophagus ir... 83 2e-18 gb|EXX56812.1| hypothetical protein RirG_212780 [Rhizophagus irr... 83 2e-18 gb|PKC54158.1| hypothetical protein RhiirA1_542975 [Rhizophagus ... 81 1e-17 gb|PKY49788.1| hypothetical protein RhiirA4_545505 [Rhizophagus ... 58 2e-08 gb|PKB96835.1| hypothetical protein RhiirA5_506825 [Rhizophagus ... 57 3e-08 >gb|PKC02690.1| hypothetical protein RhiirA5_503890 [Rhizophagus irregularis] gb|PKC59405.1| hypothetical protein RhiirA1_540505 [Rhizophagus irregularis] Length = 71 Score = 90.5 bits (223), Expect = 2e-21 Identities = 43/68 (63%), Positives = 48/68 (70%), Gaps = 6/68 (8%) Frame = -2 Query: 373 MKYIFLFIVLICTIHGLTVHALPLHE------GTRCTPGGNHGDCNLGEDCNSDADCASG 212 MKYIFLFI+LICTIHGLTVHALPLHE RCTPGG + DC E+C +D DCA G Sbjct: 1 MKYIFLFIILICTIHGLTVHALPLHEVRSSLLMKRCTPGGFNRDCGYDEECETDFDCAYG 60 Query: 211 LLCNIAED 188 L C+ D Sbjct: 61 LYCSALTD 68 >gb|PKY52509.1| hypothetical protein RhiirA4_470178 [Rhizophagus irregularis] gb|PKY60158.1| hypothetical protein RhiirA4_483545 [Rhizophagus irregularis] gb|PKY63334.1| hypothetical protein RhiirA4_491871 [Rhizophagus irregularis] Length = 72 Score = 89.4 bits (220), Expect = 7e-21 Identities = 44/71 (61%), Positives = 50/71 (70%), Gaps = 6/71 (8%) Frame = -2 Query: 373 MKYIFLFIVLICTIHGLTVHALPLHE------GTRCTPGGNHGDCNLGEDCNSDADCASG 212 MKYIFLFIVLICTIHGLTVHA PLHE RCTPG GDC +GE+C +D DC+ G Sbjct: 1 MKYIFLFIVLICTIHGLTVHASPLHEVRSSLLMKRCTPGYGLGDCGVGEECVNDDDCSPG 60 Query: 211 LLCNIAEDGIC 179 L C+ G+C Sbjct: 61 LYCD-GTAGVC 70 >dbj|GBC13850.1| hypothetical protein RIR_0250400 [Rhizophagus irregularis DAOM 181602] gb|POG60810.1| hypothetical protein GLOIN_2v1709706 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 71 Score = 88.6 bits (218), Expect = 1e-20 Identities = 43/68 (63%), Positives = 47/68 (69%), Gaps = 6/68 (8%) Frame = -2 Query: 373 MKYIFLFIVLICTIHGLTVHALPLHE------GTRCTPGGNHGDCNLGEDCNSDADCASG 212 MKYIFLFI+LICTIHGLTVHALPLHE RCTPGG + DC E C +D DCA G Sbjct: 1 MKYIFLFIILICTIHGLTVHALPLHEVRSSLLMKRCTPGGFNRDCGYDEVCETDFDCAYG 60 Query: 211 LLCNIAED 188 L C+ D Sbjct: 61 LYCSALTD 68 >gb|PKY24578.1| hypothetical protein RhiirB3_527321 [Rhizophagus irregularis] Length = 71 Score = 88.2 bits (217), Expect = 2e-20 Identities = 42/68 (61%), Positives = 47/68 (69%), Gaps = 6/68 (8%) Frame = -2 Query: 373 MKYIFLFIVLICTIHGLTVHALPLHE------GTRCTPGGNHGDCNLGEDCNSDADCASG 212 MKYIFLFI+LICTIHGLTVHA PLHE RCTPGG + DC E+C +D DCA G Sbjct: 1 MKYIFLFIILICTIHGLTVHASPLHEVRSSLLMKRCTPGGFNRDCGYDEECETDFDCAYG 60 Query: 211 LLCNIAED 188 L C+ D Sbjct: 61 LYCSALTD 68 >gb|EXX59798.1| hypothetical protein RirG_185810 [Rhizophagus irregularis DAOM 197198w] dbj|GBC49646.1| JEMT01026200.1_cds_EXX59798.1_20232 [Rhizophagus irregularis DAOM 181602] Length = 72 Score = 88.2 bits (217), Expect = 2e-20 Identities = 43/71 (60%), Positives = 50/71 (70%), Gaps = 6/71 (8%) Frame = -2 Query: 373 MKYIFLFIVLICTIHGLTVHALPLHE------GTRCTPGGNHGDCNLGEDCNSDADCASG 212 MKYIFLFIVLICTIHGLTVHA PLHE RCTPG GDC +G++C +D DC+ G Sbjct: 1 MKYIFLFIVLICTIHGLTVHASPLHEVRSSLLMKRCTPGFGLGDCGVGDECVNDNDCSPG 60 Query: 211 LLCNIAEDGIC 179 L C+ G+C Sbjct: 61 LYCDTIA-GVC 70 >gb|PKC03008.1| hypothetical protein RhiirA5_424398 [Rhizophagus irregularis] gb|PKC56935.1| hypothetical protein RhiirA1_473273 [Rhizophagus irregularis] gb|PKC62134.1| hypothetical protein RhiirA1_465568 [Rhizophagus irregularis] Length = 70 Score = 87.0 bits (214), Expect = 5e-20 Identities = 44/71 (61%), Positives = 46/71 (64%), Gaps = 6/71 (8%) Frame = -2 Query: 373 MKYIFLFIVLICTIHGLTVHALPL------HEGTRCTPGGNHGDCNLGEDCNSDADCASG 212 MKYIFLFIVLICTIHGLTVHA PL H RCTPGG GDC G+ C + DC G Sbjct: 1 MKYIFLFIVLICTIHGLTVHASPLKEVRSSHLMKRCTPGGFRGDCGAGQPCQFNGDCMMG 60 Query: 211 LLCNIAEDGIC 179 L CN GIC Sbjct: 61 LYCN----GIC 67 >gb|PKC54110.1| hypothetical protein RhiirA1_477944 [Rhizophagus irregularis] Length = 72 Score = 87.0 bits (214), Expect = 6e-20 Identities = 44/71 (61%), Positives = 48/71 (67%), Gaps = 6/71 (8%) Frame = -2 Query: 373 MKYIFLFIVLICTIHGLTVHALPLHE------GTRCTPGGNHGDCNLGEDCNSDADCASG 212 MKYIFLFIVLICTIHGLTVHA PLHE RCT GG GDC +G +C +D DC G Sbjct: 1 MKYIFLFIVLICTIHGLTVHASPLHEVRSSLLMKRCTTGGQLGDCVIGGECVTDDDCLPG 60 Query: 211 LLCNIAEDGIC 179 L CN G+C Sbjct: 61 LYCNTIV-GVC 70 >gb|PKY44991.1| hypothetical protein RhiirA4_459460 [Rhizophagus irregularis] Length = 70 Score = 86.7 bits (213), Expect = 8e-20 Identities = 43/71 (60%), Positives = 46/71 (64%), Gaps = 6/71 (8%) Frame = -2 Query: 373 MKYIFLFIVLICTIHGLTVHALPL------HEGTRCTPGGNHGDCNLGEDCNSDADCASG 212 MKYIFLF+VLICTIHGLTVHA PL H RCTPGG GDC G+ C + DC G Sbjct: 1 MKYIFLFVVLICTIHGLTVHASPLKEVRSSHLMKRCTPGGFRGDCGAGQPCQFNGDCMMG 60 Query: 211 LLCNIAEDGIC 179 L CN GIC Sbjct: 61 LYCN----GIC 67 >gb|PKK63949.1| hypothetical protein RhiirC2_854672 [Rhizophagus irregularis] Length = 71 Score = 86.3 bits (212), Expect = 1e-19 Identities = 42/68 (61%), Positives = 46/68 (67%), Gaps = 6/68 (8%) Frame = -2 Query: 373 MKYIFLFIVLICTIHGLTVHALPLHE------GTRCTPGGNHGDCNLGEDCNSDADCASG 212 MKYIFLFI+LICTIH LTVHALPLHE RCTPGG + DC E C +D DCA G Sbjct: 1 MKYIFLFIILICTIHSLTVHALPLHEVRSSLLMKRCTPGGFNRDCGYDEVCETDFDCAYG 60 Query: 211 LLCNIAED 188 L C+ D Sbjct: 61 LYCSALTD 68 >gb|POG66268.1| hypothetical protein GLOIN_2v1780765 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 72 Score = 86.3 bits (212), Expect = 1e-19 Identities = 43/71 (60%), Positives = 48/71 (67%), Gaps = 6/71 (8%) Frame = -2 Query: 373 MKYIFLFIVLICTIHGLTVHALPLHE------GTRCTPGGNHGDCNLGEDCNSDADCASG 212 MKYIFLFIVLICTIHGLTVHA PLHE RCT GG GDC +G +C +D DC G Sbjct: 1 MKYIFLFIVLICTIHGLTVHASPLHEVRSSLLMKRCTTGGQLGDCGIGGECVTDDDCLPG 60 Query: 211 LLCNIAEDGIC 179 L C+ G+C Sbjct: 61 LYCDTIV-GVC 70 >gb|PKC09693.1| hypothetical protein RhiirA5_415315 [Rhizophagus irregularis] gb|PKY31384.1| hypothetical protein RhiirB3_448962 [Rhizophagus irregularis] Length = 72 Score = 83.6 bits (205), Expect = 1e-18 Identities = 42/71 (59%), Positives = 47/71 (66%), Gaps = 6/71 (8%) Frame = -2 Query: 373 MKYIFLFIVLICTIHGLTVHALPLHE------GTRCTPGGNHGDCNLGEDCNSDADCASG 212 MKYIFLFIVLICTIHGLTVHA P HE RCT GG GDC +G +C +D DC G Sbjct: 1 MKYIFLFIVLICTIHGLTVHASPHHEVRSSLLMKRCTTGGQLGDCGIGGECVTDDDCLPG 60 Query: 211 LLCNIAEDGIC 179 L C+ G+C Sbjct: 61 LYCDTIV-GVC 70 >dbj|GBC33313.1| hypothetical protein RIR_1824600 [Rhizophagus irregularis DAOM 181602] gb|PKY35333.1| hypothetical protein RhiirB3_533146 [Rhizophagus irregularis] gb|POG79706.1| hypothetical protein GLOIN_2v1525152 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 69 Score = 82.8 bits (203), Expect = 2e-18 Identities = 45/71 (63%), Positives = 48/71 (67%), Gaps = 6/71 (8%) Frame = -2 Query: 373 MKYIFLFIVLICTIHGLTVHALPLHEGT------RCTPGGNHGDCNLGEDCNSDADCASG 212 MKYIFLFIVLICTIH LTVHA PLHE RCT GG GDCN GE+C D DCA G Sbjct: 1 MKYIFLFIVLICTIH-LTVHASPLHEVRTSLLMKRCTHGGGLGDCNKGEECFFDDDCAPG 59 Query: 211 LLCNIAEDGIC 179 L C+ + IC Sbjct: 60 LYCD--NNAIC 68 >gb|EXX56812.1| hypothetical protein RirG_212780 [Rhizophagus irregularis DAOM 197198w] dbj|GBC21799.1| JEMT01027516.1_cds_EXX56812.1_23219: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 70 Score = 82.8 bits (203), Expect = 2e-18 Identities = 40/64 (62%), Positives = 43/64 (67%), Gaps = 6/64 (9%) Frame = -2 Query: 373 MKYIFLFIVLICTIHGLTVHALPL------HEGTRCTPGGNHGDCNLGEDCNSDADCASG 212 MKYI LFIVLICTIHGLTVHA PL H RCTPGG GDC+ G+ C + DC G Sbjct: 1 MKYISLFIVLICTIHGLTVHASPLKVVRSSHLMKRCTPGGFRGDCSAGQPCQFNGDCMMG 60 Query: 211 LLCN 200 L CN Sbjct: 61 LYCN 64 >gb|PKC54158.1| hypothetical protein RhiirA1_542975 [Rhizophagus irregularis] Length = 69 Score = 81.3 bits (199), Expect = 1e-17 Identities = 44/71 (61%), Positives = 47/71 (66%), Gaps = 6/71 (8%) Frame = -2 Query: 373 MKYIFLFIVLICTIHGLTVHALPLHEGT------RCTPGGNHGDCNLGEDCNSDADCASG 212 MKYIFLFIVLICTIH LTVHA PLHE RCT GG GDCN GE+C D DC G Sbjct: 1 MKYIFLFIVLICTIH-LTVHASPLHEVRTSLLMKRCTHGGGLGDCNKGEECFFDDDCVPG 59 Query: 211 LLCNIAEDGIC 179 L C+ + IC Sbjct: 60 LYCD--NNAIC 68 >gb|PKY49788.1| hypothetical protein RhiirA4_545505 [Rhizophagus irregularis] gb|PKY61941.1| hypothetical protein RhiirA4_551078 [Rhizophagus irregularis] Length = 71 Score = 57.8 bits (138), Expect = 2e-08 Identities = 32/72 (44%), Positives = 39/72 (54%) Frame = -2 Query: 373 MKYIFLFIVLICTIHGLTVHALPLHEGTRCTPGGNHGDCNLGEDCNSDADCASGLLCNIA 194 MKY+FL +VLIC +HGLTVHA PL E R L + C +D DC SG Sbjct: 1 MKYLFLLVVLICIVHGLTVHASPLAEPDR-----------LMKRCKTDGDCPSG---KCT 46 Query: 193 EDGICCPENGNC 158 +DG C + NC Sbjct: 47 KDGTCDSVSINC 58 >gb|PKB96835.1| hypothetical protein RhiirA5_506825 [Rhizophagus irregularis] gb|PKC63676.1| hypothetical protein RhiirA1_537608 [Rhizophagus irregularis] gb|PKK61842.1| hypothetical protein RhiirC2_856030 [Rhizophagus irregularis] gb|PKY24081.1| hypothetical protein RhiirB3_526969 [Rhizophagus irregularis] Length = 71 Score = 57.0 bits (136), Expect = 3e-08 Identities = 32/72 (44%), Positives = 38/72 (52%) Frame = -2 Query: 373 MKYIFLFIVLICTIHGLTVHALPLHEGTRCTPGGNHGDCNLGEDCNSDADCASGLLCNIA 194 MKY FL +VLIC +HGLTVHA PL E R L + C +D DC SG Sbjct: 1 MKYFFLLVVLICIVHGLTVHASPLAEPDR-----------LMKRCKTDGDCPSG---KCT 46 Query: 193 EDGICCPENGNC 158 +DG C + NC Sbjct: 47 KDGTCDSVSINC 58