BLASTX nr result
ID: Ophiopogon27_contig00037917
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00037917 (419 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74396.1| hypothetical protein M569_00359, partial [Genlise... 59 1e-08 >gb|EPS74396.1| hypothetical protein M569_00359, partial [Genlisea aurea] Length = 106 Score = 59.3 bits (142), Expect = 1e-08 Identities = 37/71 (52%), Positives = 45/71 (63%), Gaps = 6/71 (8%) Frame = +2 Query: 224 IGFAPMETINFIHKKYRYMIDPHF*IVKMAFSTL---SILLVIGTGK---MVSFVRTHDL 385 IGFAPM+TI FIH Y++ F IV S+ S+ +I +GK +V FV HDL Sbjct: 1 IGFAPMKTIRFIHIS-SYLVLVFFLIVNGVRSSCLCYSLRHIIPSGKPGLLVFFVSAHDL 59 Query: 386 NESHIHPSTCS 418 NESHIHPSTCS Sbjct: 60 NESHIHPSTCS 70