BLASTX nr result
ID: Ophiopogon27_contig00037753
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00037753 (569 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PPE01014.1| hypothetical protein GOBAR_DD01977 [Gossypium bar... 56 6e-06 >gb|PPE01014.1| hypothetical protein GOBAR_DD01977 [Gossypium barbadense] Length = 382 Score = 56.2 bits (134), Expect = 6e-06 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = +1 Query: 433 LLYHPLIYGCM-ELLNNAMELQINDTVGTLALGHYHDEDTVAAVII 567 L+Y +I G M + ++N + L +NDTVGTLALGHYHD DTVAAVII Sbjct: 92 LIYIFVIXGMMLDDISNTLFLSVNDTVGTLALGHYHDADTVAAVII 137