BLASTX nr result
ID: Ophiopogon27_contig00037720
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00037720 (501 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252281.1| non-structural maintenance of chromosomes el... 68 3e-10 >ref|XP_020252281.1| non-structural maintenance of chromosomes element 4 homolog A-like [Asparagus officinalis] gb|ONK79023.1| uncharacterized protein A4U43_C01F2080 [Asparagus officinalis] Length = 368 Score = 67.8 bits (164), Expect = 3e-10 Identities = 37/77 (48%), Positives = 47/77 (61%) Frame = +3 Query: 6 ELMPHRCSMXXXXXXXXXXGRTQVGAQFQAPTPIRKVSRNRGLVVQEQSVGNCSPELEDA 185 ELMPHRC+ +TQ + Q PTPI+K SRN GLV E SVGN SPE +DA Sbjct: 293 ELMPHRCNSDTVTRNSRTGEQTQGYSHVQVPTPIKKFSRNHGLVTPENSVGNGSPEPKDA 352 Query: 186 CGNESGSPQSTKRRLIF 236 G++S Q+ KR+ +F Sbjct: 353 DGSDSS--QTRKRQCLF 367