BLASTX nr result
ID: Ophiopogon27_contig00037599
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00037599 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008790152.1| PREDICTED: AUGMIN subunit 8 [Phoenix dactyli... 55 3e-06 >ref|XP_008790152.1| PREDICTED: AUGMIN subunit 8 [Phoenix dactylifera] ref|XP_008790153.1| PREDICTED: AUGMIN subunit 8 [Phoenix dactylifera] Length = 609 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/42 (61%), Positives = 29/42 (69%) Frame = +2 Query: 233 MDKCSFEPLEVVPLLKKAQTEDTPRPPLVPSEKHNAVPVSRR 358 MD C EP V K AQTEDT RPPLVPSEK+NA P +R+ Sbjct: 1 MDVCKLEPPGTVAQQKAAQTEDTQRPPLVPSEKNNAAPATRK 42