BLASTX nr result
ID: Ophiopogon27_contig00037428
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00037428 (441 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020271216.1| mannan endo-1,4-beta-mannosidase 2-like [Asp... 60 1e-07 >ref|XP_020271216.1| mannan endo-1,4-beta-mannosidase 2-like [Asparagus officinalis] gb|ONK66822.1| uncharacterized protein A4U43_C06F12370 [Asparagus officinalis] Length = 441 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 439 GIVPGERPSLDKLMKEQSRRLAKLNYGLDLGRRGVK 332 G+VPGERPSLDKL+K+QS RLAKLNYG DLG R +K Sbjct: 403 GVVPGERPSLDKLIKDQSCRLAKLNYGKDLGGRSLK 438