BLASTX nr result
ID: Ophiopogon27_contig00037427
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00037427 (377 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK58010.1| uncharacterized protein A4U43_C09F6910 [Asparagus... 52 3e-06 >gb|ONK58010.1| uncharacterized protein A4U43_C09F6910 [Asparagus officinalis] Length = 77 Score = 51.6 bits (122), Expect = 3e-06 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 1/34 (2%) Frame = -1 Query: 317 MDADEK-KEKGQRNPNPKAANRRHGSTAFFVMVD 219 MDA+EK K+KGQRNPNP NRRHGST FFVMVD Sbjct: 1 MDANEKQKKKGQRNPNP---NRRHGSTKFFVMVD 31