BLASTX nr result
ID: Ophiopogon27_contig00037385
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00037385 (483 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KPI88275.1| putative poly-zinc finger protein 2 [Leptomonas s... 54 5e-06 >gb|KPI88275.1| putative poly-zinc finger protein 2 [Leptomonas seymouri] Length = 135 Score = 53.5 bits (127), Expect = 5e-06 Identities = 26/65 (40%), Positives = 35/65 (53%), Gaps = 6/65 (9%) Frame = +3 Query: 123 GMTSMSRKTIRPSLKAICYLCGFRGHLRALCPNVV------CFACHKFGHRALNCPWIPL 284 G+ SR+ P+ A C+ CG GH+ CP+ V CF CHK GHRA +CP P Sbjct: 8 GVGHQSRECTAPADSAPCFRCGKPGHIAKECPSTVSAEEAPCFYCHKPGHRARDCPEAPP 67 Query: 285 RRQAV 299 + + V Sbjct: 68 KSETV 72