BLASTX nr result
ID: Ophiopogon27_contig00037003
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00037003 (484 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020276881.1| probable serine/threonine-protein kinase At1... 55 1e-05 ref|XP_009411081.1| PREDICTED: probable serine/threonine-protein... 55 1e-05 >ref|XP_020276881.1| probable serine/threonine-protein kinase At1g54610 isoform X2 [Asparagus officinalis] Length = 692 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +2 Query: 2 SQSNKVDELLEKHEQHMRIAVRKSWFQRGR 91 SQS+KVDELL+KHE+H+R AVR+SWFQRGR Sbjct: 659 SQSHKVDELLQKHERHIRHAVRRSWFQRGR 688 >ref|XP_009411081.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 [Musa acuminata subsp. malaccensis] Length = 693 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 2 SQSNKVDELLEKHEQHMRIAVRKSWFQRGR 91 S+S+KVDELL+KHE+HMR A+R+SWFQRGR Sbjct: 660 SESHKVDELLQKHERHMRQAIRRSWFQRGR 689