BLASTX nr result
ID: Ophiopogon27_contig00036925
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00036925 (716 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KQL03485.1| hypothetical protein SETIT_004048mg [Setaria ital... 84 2e-16 gb|PAN31103.1| hypothetical protein PAHAL_E03062 [Panicum hallii] 86 4e-16 gb|AAP31413.1|AF457124_1 knotted1-like homeodomain protein ligul... 81 5e-16 gb|AAL87120.1| knotted class 1 homeodomain protein liguleless3, ... 81 6e-16 ref|XP_002455513.1| homeobox protein knotted-1-like 1 [Sorghum b... 85 7e-16 ref|XP_003567581.1| PREDICTED: homeobox protein knotted-1-like 1... 85 9e-16 gb|ONM31643.1| Homeobox protein liguleless 3 [Zea mays] 81 1e-15 gb|AAV50045.1| homeobox protein [Saccharum hybrid cultivar Pindar] 84 2e-15 gb|EAZ11581.1| hypothetical protein OsJ_01445 [Oryza sativa Japo... 81 2e-15 gb|EAY73669.1| hypothetical protein OsI_01553 [Oryza sativa Indi... 81 2e-15 ref|XP_004967561.1| homeobox protein knotted-1-like 1 [Setaria i... 84 3e-15 ref|XP_008813378.1| PREDICTED: homeobox protein knotted-1-like 1... 81 4e-15 gb|OEL36960.1| Homeobox protein knotted-1-like 1 [Dichanthelium ... 83 5e-15 ref|NP_001105508.1| liguleless 3 [Zea mays] >gi|4240539|gb|AAD13... 81 2e-14 dbj|BAA79224.1| knotted1-type homeobox protein OSH6 [Oryza sativa] 81 2e-14 ref|XP_015634297.1| PREDICTED: homeobox protein knotted-1-like 1... 81 2e-14 ref|XP_008781110.1| PREDICTED: homeobox protein knotted-1-like 1... 79 2e-13 ref|XP_020178258.1| homeobox protein knotted-1-like 10 [Aegilops... 78 3e-13 dbj|BAG82674.1| KN1-type homeobox transcription factor [Triticum... 78 3e-13 gb|OAY77357.1| Homeobox protein knotted-1-like 1 [Ananas comosus] 77 3e-13 >gb|KQL03485.1| hypothetical protein SETIT_004048mg [Setaria italica] Length = 161 Score = 83.6 bits (205), Expect = 2e-16 Identities = 45/62 (72%), Positives = 49/62 (79%), Gaps = 4/62 (6%) Frame = -3 Query: 174 MEDLYSIHPGISRGWEASAEIS----GGDHRSDLTDLLKAQIASHPRYPSLVSACIECRK 7 MEDLYSIHPGISR A +E S GG SDLT+L+KAQIASHPRYPSL+SA IECRK Sbjct: 1 MEDLYSIHPGISRVGGAVSEASVAGVGGPAPSDLTELMKAQIASHPRYPSLLSAYIECRK 60 Query: 6 VG 1 VG Sbjct: 61 VG 62 >gb|PAN31103.1| hypothetical protein PAHAL_E03062 [Panicum hallii] Length = 295 Score = 85.9 bits (211), Expect = 4e-16 Identities = 45/62 (72%), Positives = 50/62 (80%), Gaps = 4/62 (6%) Frame = -3 Query: 174 MEDLYSIHPGISRGWEASAEIS----GGDHRSDLTDLLKAQIASHPRYPSLVSACIECRK 7 MEDLYSIHPGISR A++E S GG SDLT+L+KAQIASHPRYPSL+SA IECRK Sbjct: 1 MEDLYSIHPGISRAGGAASEASVAGVGGPAPSDLTELMKAQIASHPRYPSLLSAYIECRK 60 Query: 6 VG 1 VG Sbjct: 61 VG 62 >gb|AAP31413.1|AF457124_1 knotted1-like homeodomain protein liguleless3, partial [Zea mays] Length = 115 Score = 81.3 bits (199), Expect = 5e-16 Identities = 44/65 (67%), Positives = 50/65 (76%), Gaps = 7/65 (10%) Frame = -3 Query: 174 MEDLYSIHPGISR---GWEASAEISG----GDHRSDLTDLLKAQIASHPRYPSLVSACIE 16 MEDLYSIHPGISR G + A ++G G SDLT+L+KAQIASHPRYPSL+SA IE Sbjct: 1 MEDLYSIHPGISRVVGGAASEASVAGAGAGGPSPSDLTELMKAQIASHPRYPSLLSAYIE 60 Query: 15 CRKVG 1 CRKVG Sbjct: 61 CRKVG 65 >gb|AAL87120.1| knotted class 1 homeodomain protein liguleless3, partial [Zea mays] Length = 120 Score = 81.3 bits (199), Expect = 6e-16 Identities = 44/65 (67%), Positives = 50/65 (76%), Gaps = 7/65 (10%) Frame = -3 Query: 174 MEDLYSIHPGISR---GWEASAEISG----GDHRSDLTDLLKAQIASHPRYPSLVSACIE 16 MEDLYSIHPGISR G + A ++G G SDLT+L+KAQIASHPRYPSL+SA IE Sbjct: 1 MEDLYSIHPGISRVVGGAASEASVAGAGAGGPSPSDLTELMKAQIASHPRYPSLLSAYIE 60 Query: 15 CRKVG 1 CRKVG Sbjct: 61 CRKVG 65 >ref|XP_002455513.1| homeobox protein knotted-1-like 1 [Sorghum bicolor] gb|EES00633.1| hypothetical protein SORBI_3003G144200 [Sorghum bicolor] Length = 294 Score = 85.1 bits (209), Expect = 7e-16 Identities = 45/62 (72%), Positives = 50/62 (80%), Gaps = 4/62 (6%) Frame = -3 Query: 174 MEDLYSIHPGISRGWEASAEIS----GGDHRSDLTDLLKAQIASHPRYPSLVSACIECRK 7 MEDLYSIHPGISR A++E S GG SDLT+L+KAQIASHPRYPSL+SA IECRK Sbjct: 1 MEDLYSIHPGISRVGGAASEASVAGVGGPSPSDLTELMKAQIASHPRYPSLLSAYIECRK 60 Query: 6 VG 1 VG Sbjct: 61 VG 62 >ref|XP_003567581.1| PREDICTED: homeobox protein knotted-1-like 1 [Brachypodium distachyon] gb|KQK04078.1| hypothetical protein BRADI_2g11540v3 [Brachypodium distachyon] Length = 290 Score = 84.7 bits (208), Expect = 9e-16 Identities = 44/62 (70%), Positives = 49/62 (79%), Gaps = 4/62 (6%) Frame = -3 Query: 174 MEDLYSIHPGISR----GWEASAEISGGDHRSDLTDLLKAQIASHPRYPSLVSACIECRK 7 MEDLYSIHPGISR EAS + GG SDLT+L+KAQIASHPRYP+L+SA IECRK Sbjct: 1 MEDLYSIHPGISRVGGAASEASGVVLGGPSPSDLTELMKAQIASHPRYPTLLSAYIECRK 60 Query: 6 VG 1 VG Sbjct: 61 VG 62 >gb|ONM31643.1| Homeobox protein liguleless 3 [Zea mays] Length = 154 Score = 81.3 bits (199), Expect = 1e-15 Identities = 44/65 (67%), Positives = 50/65 (76%), Gaps = 7/65 (10%) Frame = -3 Query: 174 MEDLYSIHPGISR---GWEASAEISG----GDHRSDLTDLLKAQIASHPRYPSLVSACIE 16 MEDLYSIHPGISR G + A ++G G SDLT+L+KAQIASHPRYPSL+SA IE Sbjct: 1 MEDLYSIHPGISRVVGGAASEASVAGAGAGGPSPSDLTELMKAQIASHPRYPSLLSAYIE 60 Query: 15 CRKVG 1 CRKVG Sbjct: 61 CRKVG 65 >gb|AAV50045.1| homeobox protein [Saccharum hybrid cultivar Pindar] Length = 315 Score = 84.3 bits (207), Expect = 2e-15 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 6/64 (9%) Frame = -3 Query: 174 MEDLYSIHPGISRGWEASAEIS------GGDHRSDLTDLLKAQIASHPRYPSLVSACIEC 13 MEDLYSIHPGISR A++E S GG SDLT+L+KAQIASHPRYPSL+SA IEC Sbjct: 1 MEDLYSIHPGISRVGGAASEASTAGVGAGGPSPSDLTELMKAQIASHPRYPSLLSAYIEC 60 Query: 12 RKVG 1 RKVG Sbjct: 61 RKVG 64 >gb|EAZ11581.1| hypothetical protein OsJ_01445 [Oryza sativa Japonica Group] Length = 169 Score = 81.3 bits (199), Expect = 2e-15 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 9/67 (13%) Frame = -3 Query: 174 MEDLYSIHPGISRGWEASAEISG---------GDHRSDLTDLLKAQIASHPRYPSLVSAC 22 MEDLYSIHPGISR A++E SG G SDLT+L+KAQIA HPRYP+L+SA Sbjct: 1 MEDLYSIHPGISRVGGAASEASGVGVVVGGGGGSSSSDLTELMKAQIAGHPRYPTLLSAY 60 Query: 21 IECRKVG 1 IECRKVG Sbjct: 61 IECRKVG 67 >gb|EAY73669.1| hypothetical protein OsI_01553 [Oryza sativa Indica Group] Length = 169 Score = 81.3 bits (199), Expect = 2e-15 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 9/67 (13%) Frame = -3 Query: 174 MEDLYSIHPGISRGWEASAEISG---------GDHRSDLTDLLKAQIASHPRYPSLVSAC 22 MEDLYSIHPGISR A++E SG G SDLT+L+KAQIA HPRYP+L+SA Sbjct: 1 MEDLYSIHPGISRVGGAASEASGVGVVVGGGGGSSSSDLTELMKAQIAGHPRYPTLLSAY 60 Query: 21 IECRKVG 1 IECRKVG Sbjct: 61 IECRKVG 67 >ref|XP_004967561.1| homeobox protein knotted-1-like 1 [Setaria italica] Length = 295 Score = 83.6 bits (205), Expect = 3e-15 Identities = 45/62 (72%), Positives = 49/62 (79%), Gaps = 4/62 (6%) Frame = -3 Query: 174 MEDLYSIHPGISRGWEASAEIS----GGDHRSDLTDLLKAQIASHPRYPSLVSACIECRK 7 MEDLYSIHPGISR A +E S GG SDLT+L+KAQIASHPRYPSL+SA IECRK Sbjct: 1 MEDLYSIHPGISRVGGAVSEASVAGVGGPAPSDLTELMKAQIASHPRYPSLLSAYIECRK 60 Query: 6 VG 1 VG Sbjct: 61 VG 62 >ref|XP_008813378.1| PREDICTED: homeobox protein knotted-1-like 1 [Phoenix dactylifera] Length = 187 Score = 80.9 bits (198), Expect = 4e-15 Identities = 48/82 (58%), Positives = 52/82 (63%), Gaps = 24/82 (29%) Frame = -3 Query: 174 MEDLYSIHPGISRGWEASA------------------------EISGGDHRSDLTDLLKA 67 MEDLYSIHPGIS+G E +A +ISGG SDLTDL+KA Sbjct: 1 MEDLYSIHPGISKGGEMAAVGSTSGYPYFEADRSHSGGAAEASDISGGGG-SDLTDLIKA 59 Query: 66 QIASHPRYPSLVSACIECRKVG 1 QIASHPRYPSLVSA IECRKVG Sbjct: 60 QIASHPRYPSLVSAYIECRKVG 81 >gb|OEL36960.1| Homeobox protein knotted-1-like 1 [Dichanthelium oligosanthes] Length = 295 Score = 82.8 bits (203), Expect = 5e-15 Identities = 44/62 (70%), Positives = 49/62 (79%), Gaps = 4/62 (6%) Frame = -3 Query: 174 MEDLYSIHPGISRGWEASAEIS----GGDHRSDLTDLLKAQIASHPRYPSLVSACIECRK 7 MEDLYSIHPGISR A++E S GG SDLT+L+KAQI SHPRYPSL+SA IECRK Sbjct: 1 MEDLYSIHPGISRVGGAASEASVAGVGGPAPSDLTELMKAQIXSHPRYPSLLSAYIECRK 60 Query: 6 VG 1 VG Sbjct: 61 VG 62 >ref|NP_001105508.1| liguleless 3 [Zea mays] gb|AAD13611.1| knotted class 1 homeodomain protein liguleless3 [Zea mays] gb|ADX60082.1| Homeobox HB transcription factor CDS, partial [Zea mays] gb|ONM31645.1| Homeobox protein liguleless 3 [Zea mays] Length = 295 Score = 81.3 bits (199), Expect = 2e-14 Identities = 44/65 (67%), Positives = 50/65 (76%), Gaps = 7/65 (10%) Frame = -3 Query: 174 MEDLYSIHPGISR---GWEASAEISG----GDHRSDLTDLLKAQIASHPRYPSLVSACIE 16 MEDLYSIHPGISR G + A ++G G SDLT+L+KAQIASHPRYPSL+SA IE Sbjct: 1 MEDLYSIHPGISRVVGGAASEASVAGAGAGGPSPSDLTELMKAQIASHPRYPSLLSAYIE 60 Query: 15 CRKVG 1 CRKVG Sbjct: 61 CRKVG 65 >dbj|BAA79224.1| knotted1-type homeobox protein OSH6 [Oryza sativa] Length = 301 Score = 81.3 bits (199), Expect = 2e-14 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 9/67 (13%) Frame = -3 Query: 174 MEDLYSIHPGISRGWEASAEISG---------GDHRSDLTDLLKAQIASHPRYPSLVSAC 22 MEDLYSIHPGISR A++E SG G SDLT+L+KAQIA HPRYP+L+SA Sbjct: 1 MEDLYSIHPGISRVGGAASEASGVGVVVGGGGGSSSSDLTELMKAQIAGHPRYPTLLSAY 60 Query: 21 IECRKVG 1 IECRKVG Sbjct: 61 IECRKVG 67 >ref|XP_015634297.1| PREDICTED: homeobox protein knotted-1-like 1 [Oryza sativa Japonica Group] sp|Q9FP29.1|KNOS1_ORYSJ RecName: Full=Homeobox protein knotted-1-like 1; AltName: Full=Homeobox protein HOS16; AltName: Full=Homeobox protein OSH6 dbj|BAB19772.1| putative knotted1-type homeobox protein [Oryza sativa Japonica Group] dbj|BAB93157.1| knotted1-type homeobox protein OSH6 [Oryza sativa Japonica Group] dbj|BAF04741.1| Os01g0302500 [Oryza sativa Japonica Group] dbj|BAS71730.1| Os01g0302500 [Oryza sativa Japonica Group] Length = 301 Score = 81.3 bits (199), Expect = 2e-14 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 9/67 (13%) Frame = -3 Query: 174 MEDLYSIHPGISRGWEASAEISG---------GDHRSDLTDLLKAQIASHPRYPSLVSAC 22 MEDLYSIHPGISR A++E SG G SDLT+L+KAQIA HPRYP+L+SA Sbjct: 1 MEDLYSIHPGISRVGGAASEASGVGVVVGGGGGSSSSDLTELMKAQIAGHPRYPTLLSAY 60 Query: 21 IECRKVG 1 IECRKVG Sbjct: 61 IECRKVG 67 >ref|XP_008781110.1| PREDICTED: homeobox protein knotted-1-like 1 [Phoenix dactylifera] Length = 318 Score = 79.0 bits (193), Expect = 2e-13 Identities = 45/84 (53%), Positives = 50/84 (59%), Gaps = 26/84 (30%) Frame = -3 Query: 174 MEDLYSIHPGISRGWEASA--------------------------EISGGDHRSDLTDLL 73 MEDLYSIHPGISRG E +A +GG SDLTDL+ Sbjct: 1 MEDLYSIHPGISRGGEVAAVGSTSSFACFEADRSQCGEATEASDISAAGGAGGSDLTDLI 60 Query: 72 KAQIASHPRYPSLVSACIECRKVG 1 KAQIA+HPRYPSLV+A IECRKVG Sbjct: 61 KAQIANHPRYPSLVAAYIECRKVG 84 >ref|XP_020178258.1| homeobox protein knotted-1-like 10 [Aegilops tauschii subsp. tauschii] Length = 306 Score = 78.2 bits (191), Expect = 3e-13 Identities = 43/71 (60%), Positives = 49/71 (69%), Gaps = 13/71 (18%) Frame = -3 Query: 174 MEDLYSIHPGISRGWEASAE------ISGGDHR-------SDLTDLLKAQIASHPRYPSL 34 MEDLYSIHPGISRG E A ++GG +DLT+L+KAQIA HPRYPSL Sbjct: 1 MEDLYSIHPGISRGGEGGAACSEASGVAGGASSPPPPPPPADLTELMKAQIAGHPRYPSL 60 Query: 33 VSACIECRKVG 1 +SA IECRKVG Sbjct: 61 LSAYIECRKVG 71 >dbj|BAG82674.1| KN1-type homeobox transcription factor [Triticum aestivum] Length = 306 Score = 78.2 bits (191), Expect = 3e-13 Identities = 43/71 (60%), Positives = 49/71 (69%), Gaps = 13/71 (18%) Frame = -3 Query: 174 MEDLYSIHPGISRGWEASAE------ISGGDHR-------SDLTDLLKAQIASHPRYPSL 34 MEDLYSIHPGISRG E A ++GG +DLT+L+KAQIA HPRYPSL Sbjct: 1 MEDLYSIHPGISRGGEGGAACSEASGVAGGASSPPPPPPPADLTELMKAQIAGHPRYPSL 60 Query: 33 VSACIECRKVG 1 +SA IECRKVG Sbjct: 61 LSAYIECRKVG 71 >gb|OAY77357.1| Homeobox protein knotted-1-like 1 [Ananas comosus] Length = 269 Score = 77.4 bits (189), Expect = 3e-13 Identities = 45/77 (58%), Positives = 50/77 (64%), Gaps = 19/77 (24%) Frame = -3 Query: 174 MEDLYSIHPGISRGWEA------------------SAEISGGDH-RSDLTDLLKAQIASH 52 MEDLYSIHPGISRG ++EISGG SDL D++KAQIASH Sbjct: 1 MEDLYSIHPGISRGAGELDGDHHHHRRRRRGVAGDASEISGGSGGASDLNDMIKAQIASH 60 Query: 51 PRYPSLVSACIECRKVG 1 PRYPSLVSA I+CRKVG Sbjct: 61 PRYPSLVSAYIDCRKVG 77