BLASTX nr result
ID: Ophiopogon27_contig00036668
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00036668 (765 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY17551.1| RNA-binding domain-containing protein [Rhizophagu... 72 3e-12 gb|PKY41172.1| RNA-binding domain-containing protein [Rhizophagu... 72 3e-12 gb|PKC14366.1| RNA-binding domain-containing protein [Rhizophagu... 72 3e-12 dbj|GBC26269.1| glycine-rich RNA-binding protein 2 [Rhizophagus ... 72 6e-11 gb|KEQ65147.1| hypothetical protein M437DRAFT_12863, partial [Au... 66 2e-10 gb|KEQ82274.1| RNA-binding domain-containing protein, partial [A... 65 3e-10 ref|XP_002840273.1| hypothetical protein [Tuber melanosporum Mel... 65 4e-10 ref|XP_018078384.1| RNA-binding domain-containing protein [Phial... 66 9e-10 gb|OXV11256.1| hypothetical protein Egran_00983 [Elaphomyces gra... 65 1e-09 gb|OBW68002.1| Uncharacterized protein AUREO_019430 [Aureobasidi... 65 2e-09 ref|XP_013347216.1| hypothetical protein AUEXF2481DRAFT_1867 [Au... 65 2e-09 ref|XP_007777322.1| hypothetical protein W97_01224 [Coniosporium... 65 2e-09 ref|XP_001818346.1| unnamed protein product [Aspergillus oryzae ... 64 2e-09 ref|XP_002373568.1| glycine-rich RNA-binding protein, putative [... 64 2e-09 ref|XP_022583125.1| hypothetical protein ASPZODRAFT_130704 [Peni... 64 2e-09 ref|XP_018247184.1| hypothetical protein FOXG_09777 [Fusarium ox... 63 2e-09 gb|EXA36075.1| hypothetical protein FOVG_13184 [Fusarium oxyspor... 63 2e-09 gb|KDQ57656.1| hypothetical protein JAAARDRAFT_193951 [Jaapia ar... 65 3e-09 dbj|GAO85437.1| glycine-rich RNA-binding protein 4, mitochondria... 64 3e-09 ref|XP_018288262.1| hypothetical protein PHYBLDRAFT_95547, parti... 62 3e-09 >gb|PKY17551.1| RNA-binding domain-containing protein [Rhizophagus irregularis] Length = 128 Score = 72.0 bits (175), Expect = 3e-12 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +2 Query: 26 GRSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRASE 148 GRSRGFGFVT++SNEEAE AIQN+N+ EFDGR IKVDRA+E Sbjct: 41 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAE 81 >gb|PKY41172.1| RNA-binding domain-containing protein [Rhizophagus irregularis] Length = 133 Score = 72.0 bits (175), Expect = 3e-12 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +2 Query: 26 GRSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRASE 148 GRSRGFGFVT++SNEEAE AIQN+N+ EFDGR IKVDRA+E Sbjct: 41 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAE 81 >gb|PKC14366.1| RNA-binding domain-containing protein [Rhizophagus irregularis] gb|PKC70041.1| RNA-binding domain-containing protein [Rhizophagus irregularis] gb|PKK73911.1| RNA-binding domain-containing protein [Rhizophagus irregularis] gb|POG68613.1| hypothetical protein GLOIN_2v1635358 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 134 Score = 72.0 bits (175), Expect = 3e-12 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +2 Query: 26 GRSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRASE 148 GRSRGFGFVT++SNEEAE AIQN+N+ EFDGR IKVDRA+E Sbjct: 41 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAE 81 >dbj|GBC26269.1| glycine-rich RNA-binding protein 2 [Rhizophagus irregularis DAOM 181602] Length = 319 Score = 72.0 bits (175), Expect = 6e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +2 Query: 26 GRSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRASE 148 GRSRGFGFVT++SNEEAE AIQN+N+ EFDGR IKVDRA+E Sbjct: 226 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAE 266 >gb|KEQ65147.1| hypothetical protein M437DRAFT_12863, partial [Aureobasidium melanogenum CBS 110374] Length = 79 Score = 65.9 bits (159), Expect = 2e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +2 Query: 26 GRSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRASE 148 GRSRGFGFV +S+ EEA+AAI+ MNE EFDGRTI+VD+ASE Sbjct: 33 GRSRGFGFVRFSNEEEADAAIKAMNEIEFDGRTIRVDKASE 73 >gb|KEQ82274.1| RNA-binding domain-containing protein, partial [Aureobasidium pullulans EXF-150] Length = 89 Score = 65.5 bits (158), Expect = 3e-10 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +2 Query: 26 GRSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRASE 148 GRSRGFGFV +S+ +EA+AAI+ MNE EFDGRTI+VD+ASE Sbjct: 32 GRSRGFGFVRFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 72 >ref|XP_002840273.1| hypothetical protein [Tuber melanosporum Mel28] emb|CAZ84464.1| unnamed protein product [Tuber melanosporum] Length = 91 Score = 65.1 bits (157), Expect = 4e-10 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +2 Query: 26 GRSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRASE 148 GRSRGFGFV YSS+EEA AA+ NMN+ EFDGR I+VD+AS+ Sbjct: 40 GRSRGFGFVRYSSDEEATAAMDNMNDVEFDGRRIRVDKASD 80 >ref|XP_018078384.1| RNA-binding domain-containing protein [Phialocephala scopiformis] gb|KUJ24029.1| RNA-binding domain-containing protein [Phialocephala scopiformis] Length = 164 Score = 66.2 bits (160), Expect = 9e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +2 Query: 26 GRSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRASE 148 GRSRGFGFV Y+S +EAEAAI +MN EFDGRTI+VD+ASE Sbjct: 40 GRSRGFGFVRYTSEQEAEAAINSMNNIEFDGRTIRVDKASE 80 >gb|OXV11256.1| hypothetical protein Egran_00983 [Elaphomyces granulatus] Length = 121 Score = 64.7 bits (156), Expect = 1e-09 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +2 Query: 26 GRSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRASE 148 GRSRGFGFV YSS +A+AAI MN QEFDGRTI+VD+AS+ Sbjct: 40 GRSRGFGFVRYSSEADADAAIDAMNNQEFDGRTIRVDKASD 80 >gb|OBW68002.1| Uncharacterized protein AUREO_019430 [Aureobasidium pullulans] Length = 168 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +2 Query: 26 GRSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRASE 148 GRSRGFGFV +S+ +EA+AAI+ MNE EFDGRTI+VD+ASE Sbjct: 40 GRSRGFGFVRFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 80 >ref|XP_013347216.1| hypothetical protein AUEXF2481DRAFT_1867 [Aureobasidium subglaciale EXF-2481] gb|KEQ99049.1| hypothetical protein AUEXF2481DRAFT_1867 [Aureobasidium subglaciale EXF-2481] Length = 172 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +2 Query: 26 GRSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRASE 148 GRSRGFGFV +S+ +EA+AAI+ MNE EFDGRTI+VD+ASE Sbjct: 40 GRSRGFGFVRFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 80 >ref|XP_007777322.1| hypothetical protein W97_01224 [Coniosporium apollinis CBS 100218] gb|EON62005.1| hypothetical protein W97_01224 [Coniosporium apollinis CBS 100218] Length = 172 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +2 Query: 26 GRSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRASE 148 GRSRGFGFV +S++ EA+AAIQ+MN EFDGRTI+VD+ASE Sbjct: 40 GRSRGFGFVRFSNDSEADAAIQSMNNVEFDGRTIRVDKASE 80 >ref|XP_001818346.1| unnamed protein product [Aspergillus oryzae RIB40] dbj|BAE56344.1| unnamed protein product [Aspergillus oryzae RIB40] Length = 127 Score = 64.3 bits (155), Expect = 2e-09 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +2 Query: 26 GRSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRASE 148 GRSRGFGFV +SS +AEAA MN QEFDGRTI+VD+ASE Sbjct: 40 GRSRGFGFVRFSSEADAEAAAHEMNNQEFDGRTIRVDKASE 80 >ref|XP_002373568.1| glycine-rich RNA-binding protein, putative [Aspergillus flavus NRRL3357] gb|EED57956.1| glycine-rich RNA-binding protein, putative [Aspergillus flavus NRRL3357] gb|KOC16550.1| glycine-rich RNA-binding protein [Aspergillus flavus AF70] gb|OOO12460.1| RNP-1 like RNA-binding protein [Aspergillus oryzae] Length = 127 Score = 64.3 bits (155), Expect = 2e-09 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +2 Query: 26 GRSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRASE 148 GRSRGFGFV +SS +AEAA MN QEFDGRTI+VD+ASE Sbjct: 40 GRSRGFGFVRFSSEADAEAAAHEMNNQEFDGRTIRVDKASE 80 >ref|XP_022583125.1| hypothetical protein ASPZODRAFT_130704 [Penicilliopsis zonata CBS 506.65] gb|OJJ48615.1| hypothetical protein ASPZODRAFT_130704 [Penicilliopsis zonata CBS 506.65] Length = 129 Score = 64.3 bits (155), Expect = 2e-09 Identities = 29/40 (72%), Positives = 37/40 (92%) Frame = +2 Query: 29 RSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRASE 148 RSRGFGFV ++++EEA+AA+Q MN QEFDGRTI+VD+ASE Sbjct: 41 RSRGFGFVRFATDEEADAAMQAMNNQEFDGRTIRVDKASE 80 >ref|XP_018247184.1| hypothetical protein FOXG_09777 [Fusarium oxysporum f. sp. lycopersici 4287] gb|EWY83670.1| hypothetical protein FOYG_13469 [Fusarium oxysporum FOSC 3-a] gb|EXK29209.1| hypothetical protein FOMG_14380 [Fusarium oxysporum f. sp. melonis 26406] gb|KNB09139.1| hypothetical protein FOXG_09777 [Fusarium oxysporum f. sp. lycopersici 4287] Length = 79 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +2 Query: 26 GRSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRASE 148 GRSRGFGFVT+SS EEA AAI+ MNEQEF+GR I+V A++ Sbjct: 7 GRSRGFGFVTFSSQEEASAAIEAMNEQEFEGRQIRVSEANQ 47 >gb|EXA36075.1| hypothetical protein FOVG_13184 [Fusarium oxysporum f. sp. pisi HDV247] gb|EXK84825.1| hypothetical protein FOQG_11067 [Fusarium oxysporum f. sp. raphani 54005] gb|EXL75322.1| hypothetical protein FOPG_09659 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gb|EXM17855.1| hypothetical protein FOTG_14090 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 80 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +2 Query: 26 GRSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRASE 148 GRSRGFGFVT+SS EEA AAI+ MNEQEF+GR I+V A++ Sbjct: 7 GRSRGFGFVTFSSQEEASAAIEAMNEQEFEGRQIRVSEANQ 47 >gb|KDQ57656.1| hypothetical protein JAAARDRAFT_193951 [Jaapia argillacea MUCL 33604] Length = 158 Score = 64.7 bits (156), Expect = 3e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +2 Query: 26 GRSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRAS 145 GRSRGFGFVTYSS++EAEAAI +MNEQE DGR IKV+ A+ Sbjct: 41 GRSRGFGFVTYSSSQEAEAAIASMNEQELDGRRIKVNLAN 80 >dbj|GAO85437.1| glycine-rich RNA-binding protein 4, mitochondrial [Aspergillus udagawae] Length = 129 Score = 63.9 bits (154), Expect = 3e-09 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = +2 Query: 29 RSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRASE 148 RSRGFGFV +S++ EA+ A++NMN QEFDGRTI+VD+ASE Sbjct: 41 RSRGFGFVRFSNDSEADTAMENMNNQEFDGRTIRVDKASE 80 >ref|XP_018288262.1| hypothetical protein PHYBLDRAFT_95547, partial [Phycomyces blakesleeanus NRRL 1555(-)] gb|OAD70222.1| hypothetical protein PHYBLDRAFT_95547, partial [Phycomyces blakesleeanus NRRL 1555(-)] Length = 78 Score = 62.4 bits (150), Expect = 3e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +2 Query: 26 GRSRGFGFVTYSSNEEAEAAIQNMNEQEFDGRTIKVDRAS 145 GRSRGFGFVTYSS+ EA+AAI +NEQE DGR IKV+ AS Sbjct: 37 GRSRGFGFVTYSSDSEAQAAIDALNEQELDGRRIKVNMAS 76