BLASTX nr result
ID: Ophiopogon27_contig00036617
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00036617 (450 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022745955.1| 60S ribosomal protein L6-like [Durio zibethi... 87 3e-18 ref|XP_018678376.1| PREDICTED: 60S ribosomal protein L6-like [Mu... 87 5e-18 ref|XP_009418480.1| PREDICTED: 60S ribosomal protein L6-like [Mu... 87 5e-18 ref|XP_010943581.1| PREDICTED: 60S ribosomal protein L6 [Elaeis ... 86 5e-18 ref|XP_020261456.1| LOW QUALITY PROTEIN: 60S ribosomal protein L... 86 9e-18 ref|XP_008800660.1| PREDICTED: 60S ribosomal protein L6-like [Ph... 86 9e-18 ref|XP_020265166.1| 60S ribosomal protein L6-like [Asparagus off... 86 9e-18 gb|KJB76633.1| hypothetical protein B456_012G100600 [Gossypium r... 83 1e-17 gb|KJB76631.1| hypothetical protein B456_012G100600 [Gossypium r... 83 5e-17 ref|XP_008795742.1| PREDICTED: 60S ribosomal protein L6-like [Ph... 84 6e-17 ref|XP_022742802.1| 60S ribosomal protein L6-like [Durio zibethi... 84 9e-17 ref|XP_022766759.1| 60S ribosomal protein L6-1-like [Durio zibet... 84 9e-17 gb|OMO83352.1| Ribosomal protein L6E [Corchorus olitorius] 84 9e-17 ref|XP_016738223.1| PREDICTED: 60S ribosomal protein L6-like [Go... 83 1e-16 ref|XP_012460034.1| PREDICTED: 60S ribosomal protein L6-like [Go... 83 1e-16 ref|XP_017616078.1| PREDICTED: 60S ribosomal protein L6-like [Go... 83 1e-16 ref|XP_022747101.1| 60S ribosomal protein L6-like isoform X1 [Du... 83 1e-16 ref|XP_016680945.1| PREDICTED: 60S ribosomal protein L6-like [Go... 83 2e-16 gb|KJB16392.1| hypothetical protein B456_002G228400 [Gossypium r... 80 3e-16 gb|AQK53241.1| 60S ribosomal protein L6 [Zea mays] 79 3e-16 >ref|XP_022745955.1| 60S ribosomal protein L6-like [Durio zibethinus] Length = 233 Score = 87.4 bits (215), Expect = 3e-18 Identities = 43/57 (75%), Positives = 46/57 (80%) Frame = -2 Query: 179 PILRETAPKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 P E APKFYP D VK +PN+RKP PTKLRASITPG V +LLAGRFMGKRVVFLK Sbjct: 55 PAAAEKAPKFYPADDVKKPLPNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLK 111 >ref|XP_018678376.1| PREDICTED: 60S ribosomal protein L6-like [Musa acuminata subsp. malaccensis] Length = 234 Score = 87.0 bits (214), Expect = 5e-18 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = -2 Query: 158 PKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 PKFYP D VKT IPNRRKP PTKLRASITPG V +LLAGRFMGKRVVFLK Sbjct: 63 PKFYPADDVKTPIPNRRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLK 112 >ref|XP_009418480.1| PREDICTED: 60S ribosomal protein L6-like [Musa acuminata subsp. malaccensis] Length = 234 Score = 87.0 bits (214), Expect = 5e-18 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = -2 Query: 158 PKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 PKFYP D VKT IPNRRKP PTKLRASITPG V +LLAGRFMGKRVVFLK Sbjct: 63 PKFYPADDVKTPIPNRRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLK 112 >ref|XP_010943581.1| PREDICTED: 60S ribosomal protein L6 [Elaeis guineensis] Length = 202 Score = 86.3 bits (212), Expect = 5e-18 Identities = 43/53 (81%), Positives = 44/53 (83%) Frame = -2 Query: 167 ETAPKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 E APKFYP D VKT IPN RKP PTKLR SITPG V +LLAGRFMGKRVVFLK Sbjct: 28 EKAPKFYPADDVKTPIPNHRKPKPTKLRPSITPGTVLILLAGRFMGKRVVFLK 80 >ref|XP_020261456.1| LOW QUALITY PROTEIN: 60S ribosomal protein L6-2-like [Asparagus officinalis] Length = 232 Score = 86.3 bits (212), Expect = 9e-18 Identities = 43/53 (81%), Positives = 44/53 (83%) Frame = -2 Query: 167 ETAPKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 E PKFYP D VKT IPNRRKP PTKLR SITPG V +LLAGRFMGKRVVFLK Sbjct: 58 EKPPKFYPADDVKTPIPNRRKPKPTKLRPSITPGTVLILLAGRFMGKRVVFLK 110 >ref|XP_008800660.1| PREDICTED: 60S ribosomal protein L6-like [Phoenix dactylifera] Length = 232 Score = 86.3 bits (212), Expect = 9e-18 Identities = 43/53 (81%), Positives = 44/53 (83%) Frame = -2 Query: 167 ETAPKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 E PKFYP D VKT IPNRRKP PTKLR SITPG V +LLAGRFMGKRVVFLK Sbjct: 58 EKPPKFYPADDVKTPIPNRRKPKPTKLRPSITPGTVLILLAGRFMGKRVVFLK 110 >ref|XP_020265166.1| 60S ribosomal protein L6-like [Asparagus officinalis] gb|ONK68065.1| uncharacterized protein A4U43_C05F7040 [Asparagus officinalis] Length = 233 Score = 86.3 bits (212), Expect = 9e-18 Identities = 43/53 (81%), Positives = 44/53 (83%) Frame = -2 Query: 167 ETAPKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 E PKFYP D VK IPNRRKP PTKLRASITPG V +LLAGRFMGKRVVFLK Sbjct: 59 EKPPKFYPADDVKAPIPNRRKPKPTKLRASITPGAVLILLAGRFMGKRVVFLK 111 >gb|KJB76633.1| hypothetical protein B456_012G100600 [Gossypium raimondii] Length = 130 Score = 83.2 bits (204), Expect = 1e-17 Identities = 41/57 (71%), Positives = 46/57 (80%) Frame = -2 Query: 179 PILRETAPKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 P+ E APKFYP + VK + N+RKP PTKLRASITPG V +LLAGRFMGKRVVFLK Sbjct: 55 PVAPEKAPKFYPAEDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLK 111 >gb|KJB76631.1| hypothetical protein B456_012G100600 [Gossypium raimondii] Length = 187 Score = 83.2 bits (204), Expect = 5e-17 Identities = 41/57 (71%), Positives = 46/57 (80%) Frame = -2 Query: 179 PILRETAPKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 P+ E APKFYP + VK + N+RKP PTKLRASITPG V +LLAGRFMGKRVVFLK Sbjct: 55 PVAPEKAPKFYPAEDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLK 111 >ref|XP_008795742.1| PREDICTED: 60S ribosomal protein L6-like [Phoenix dactylifera] Length = 232 Score = 84.0 bits (206), Expect = 6e-17 Identities = 42/53 (79%), Positives = 43/53 (81%) Frame = -2 Query: 167 ETAPKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 E PKFYP D VK IPNRRKP PTKLR SITPG V +LLAGRFMGKRVVFLK Sbjct: 58 EKPPKFYPADDVKIPIPNRRKPKPTKLRPSITPGTVLILLAGRFMGKRVVFLK 110 >ref|XP_022742802.1| 60S ribosomal protein L6-like [Durio zibethinus] Length = 233 Score = 83.6 bits (205), Expect = 9e-17 Identities = 42/57 (73%), Positives = 45/57 (78%) Frame = -2 Query: 179 PILRETAPKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 P E APKFYP D VK + N+RKP PTKLRASITPG V +LLAGRFMGKRVVFLK Sbjct: 55 PAAAEKAPKFYPADDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLK 111 >ref|XP_022766759.1| 60S ribosomal protein L6-1-like [Durio zibethinus] Length = 233 Score = 83.6 bits (205), Expect = 9e-17 Identities = 42/57 (73%), Positives = 45/57 (78%) Frame = -2 Query: 179 PILRETAPKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 P E APKFYP D VK + N+RKP PTKLRASITPG V +LLAGRFMGKRVVFLK Sbjct: 55 PAAAEKAPKFYPADDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLK 111 >gb|OMO83352.1| Ribosomal protein L6E [Corchorus olitorius] Length = 233 Score = 83.6 bits (205), Expect = 9e-17 Identities = 42/57 (73%), Positives = 45/57 (78%) Frame = -2 Query: 179 PILRETAPKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 P E APKFYP D VK + N+RKP PTKLRASITPG V +LLAGRFMGKRVVFLK Sbjct: 55 PAAAEKAPKFYPADDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLK 111 >ref|XP_016738223.1| PREDICTED: 60S ribosomal protein L6-like [Gossypium hirsutum] ref|XP_016738224.1| PREDICTED: 60S ribosomal protein L6-like [Gossypium hirsutum] Length = 232 Score = 83.2 bits (204), Expect = 1e-16 Identities = 41/57 (71%), Positives = 46/57 (80%) Frame = -2 Query: 179 PILRETAPKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 P+ E APKFYP + VK + N+RKP PTKLRASITPG V +LLAGRFMGKRVVFLK Sbjct: 55 PVAPEKAPKFYPAEDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLK 111 >ref|XP_012460034.1| PREDICTED: 60S ribosomal protein L6-like [Gossypium raimondii] ref|XP_012460035.1| PREDICTED: 60S ribosomal protein L6-like [Gossypium raimondii] gb|KJB76628.1| hypothetical protein B456_012G100600 [Gossypium raimondii] gb|KJB76629.1| hypothetical protein B456_012G100600 [Gossypium raimondii] gb|KJB76630.1| hypothetical protein B456_012G100600 [Gossypium raimondii] gb|KJB76632.1| hypothetical protein B456_012G100600 [Gossypium raimondii] Length = 232 Score = 83.2 bits (204), Expect = 1e-16 Identities = 41/57 (71%), Positives = 46/57 (80%) Frame = -2 Query: 179 PILRETAPKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 P+ E APKFYP + VK + N+RKP PTKLRASITPG V +LLAGRFMGKRVVFLK Sbjct: 55 PVAPEKAPKFYPAEDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLK 111 >ref|XP_017616078.1| PREDICTED: 60S ribosomal protein L6-like [Gossypium arboreum] ref|XP_017616079.1| PREDICTED: 60S ribosomal protein L6-like [Gossypium arboreum] gb|KHG17855.1| 60S ribosomal L6 [Gossypium arboreum] Length = 232 Score = 83.2 bits (204), Expect = 1e-16 Identities = 41/57 (71%), Positives = 46/57 (80%) Frame = -2 Query: 179 PILRETAPKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 P+ E APKFYP + VK + N+RKP PTKLRASITPG V +LLAGRFMGKRVVFLK Sbjct: 55 PVAPEKAPKFYPAEDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLK 111 >ref|XP_022747101.1| 60S ribosomal protein L6-like isoform X1 [Durio zibethinus] Length = 233 Score = 83.2 bits (204), Expect = 1e-16 Identities = 41/57 (71%), Positives = 45/57 (78%) Frame = -2 Query: 179 PILRETAPKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 P E +PKFYP D VK + N+RKP PTKLRASITPG V +LLAGRFMGKRVVFLK Sbjct: 55 PAAAEKSPKFYPADDVKRALLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLK 111 >ref|XP_016680945.1| PREDICTED: 60S ribosomal protein L6-like [Gossypium hirsutum] Length = 233 Score = 82.8 bits (203), Expect = 2e-16 Identities = 40/57 (70%), Positives = 46/57 (80%) Frame = -2 Query: 179 PILRETAPKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 P+ E APKFYP + VK + N+RKP PTKLRASITPG V +LLAGRFMGKR+VFLK Sbjct: 55 PVAPEKAPKFYPAEDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRIVFLK 111 >gb|KJB16392.1| hypothetical protein B456_002G228400 [Gossypium raimondii] Length = 140 Score = 80.1 bits (196), Expect = 3e-16 Identities = 40/57 (70%), Positives = 44/57 (77%) Frame = -2 Query: 179 PILRETAPKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 P E PKFYP + VK + N+RKP PTKLRASITPG V +LLAGRFMGKRVVFLK Sbjct: 55 PAAAEKPPKFYPAEDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLK 111 >gb|AQK53241.1| 60S ribosomal protein L6 [Zea mays] Length = 116 Score = 79.3 bits (194), Expect = 3e-16 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = -2 Query: 158 PKFYPVDVVKTLIPNRRKP*PTKLRASITPGIVFMLLAGRFMGKRVVFLK 9 PKFYP D VK +P+ RKP PTKLR+SITPG V +LLAGRFMGKRVVFLK Sbjct: 48 PKFYPADDVKPRVPSTRKPKPTKLRSSITPGTVLILLAGRFMGKRVVFLK 97