BLASTX nr result
ID: Ophiopogon27_contig00036532
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00036532 (509 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242331.1| copper-transporting ATPase PAA1, chloroplast... 56 5e-06 gb|ONK60702.1| uncharacterized protein A4U43_C08F21670 [Asparagu... 56 5e-06 ref|XP_020242330.1| copper-transporting ATPase PAA1, chloroplast... 56 5e-06 ref|XP_015886251.1| PREDICTED: copper-transporting ATPase PAA1, ... 55 9e-06 >ref|XP_020242331.1| copper-transporting ATPase PAA1, chloroplastic isoform X2 [Asparagus officinalis] Length = 644 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 420 VLSGVKPDQKKKFICELQESRNVVAMVGDG 509 VLS VKPDQKKKFICELQES+ VVAMVGDG Sbjct: 464 VLSRVKPDQKKKFICELQESQKVVAMVGDG 493 >gb|ONK60702.1| uncharacterized protein A4U43_C08F21670 [Asparagus officinalis] Length = 793 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 420 VLSGVKPDQKKKFICELQESRNVVAMVGDG 509 VLS VKPDQKKKFICELQES+ VVAMVGDG Sbjct: 613 VLSRVKPDQKKKFICELQESQKVVAMVGDG 642 >ref|XP_020242330.1| copper-transporting ATPase PAA1, chloroplastic isoform X1 [Asparagus officinalis] Length = 806 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 420 VLSGVKPDQKKKFICELQESRNVVAMVGDG 509 VLS VKPDQKKKFICELQES+ VVAMVGDG Sbjct: 626 VLSRVKPDQKKKFICELQESQKVVAMVGDG 655 >ref|XP_015886251.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic [Ziziphus jujuba] Length = 829 Score = 55.5 bits (132), Expect = 9e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 420 VLSGVKPDQKKKFICELQESRNVVAMVGDG 509 VLSGVKP++KKKFIC+LQE +N+VAMVGDG Sbjct: 653 VLSGVKPEEKKKFICKLQEDQNIVAMVGDG 682