BLASTX nr result
ID: Ophiopogon27_contig00036352
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00036352 (462 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK75218.1| uncharacterized protein A4U43_C03F14590 [Asparagu... 60 5e-09 >gb|ONK75218.1| uncharacterized protein A4U43_C03F14590 [Asparagus officinalis] Length = 105 Score = 60.5 bits (145), Expect = 5e-09 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +2 Query: 8 TLQSSNSNVSELDRQKTEDCRKGGQWITSDSDFVVLEL 121 TLQSS+SNVS LD +E+C +GGQWITSD DFVVLEL Sbjct: 68 TLQSSSSNVSTLDTPNSEECSRGGQWITSDCDFVVLEL 105