BLASTX nr result
ID: Ophiopogon27_contig00036274
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00036274 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PRQ60464.1| putative histidine kinase-like ATPase domain-cont... 55 8e-06 ref|XP_018716085.1| PREDICTED: uncharacterized protein LOC104417... 55 8e-06 gb|PON72058.1| Histidine kinase-like ATPase, C-terminal domain c... 55 8e-06 >gb|PRQ60464.1| putative histidine kinase-like ATPase domain-containing protein [Rosa chinensis] Length = 844 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = +2 Query: 26 MDLAEIEGGKLVVTNLHSSYGPDFVFQLHLTVLEDPI*KCPS 151 +DLAEI+GG++ +TNLHS GPDFVFQL + +D + KC S Sbjct: 327 VDLAEIQGGEIAITNLHSCNGPDFVFQLQFSCKQDNMSKCKS 368 >ref|XP_018716085.1| PREDICTED: uncharacterized protein LOC104417896 [Eucalyptus grandis] Length = 877 Score = 54.7 bits (130), Expect = 8e-06 Identities = 21/35 (60%), Positives = 30/35 (85%) Frame = +2 Query: 26 MDLAEIEGGKLVVTNLHSSYGPDFVFQLHLTVLED 130 +DLAEIEGG++ +TNLHS +GPDF+ Q+H ++ ED Sbjct: 113 IDLAEIEGGEVAITNLHSCHGPDFIIQVHFSITED 147 >gb|PON72058.1| Histidine kinase-like ATPase, C-terminal domain containing protein [Parasponia andersonii] Length = 3606 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/42 (54%), Positives = 31/42 (73%) Frame = +2 Query: 29 DLAEIEGGKLVVTNLHSSYGPDFVFQLHLTVLEDPI*KCPST 154 DLAEIEGG++ +TNLHS GPDF+ QLH + +D + K P + Sbjct: 1899 DLAEIEGGEVAITNLHSCNGPDFILQLHFSFKQDSVTKSPGS 1940