BLASTX nr result
ID: Ophiopogon27_contig00036269
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00036269 (405 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003577549.1| PREDICTED: pentatricopeptide repeat-containi... 85 1e-16 ref|XP_020110905.1| pentatricopeptide repeat-containing protein ... 85 1e-16 ref|XP_020695213.1| pentatricopeptide repeat-containing protein ... 84 3e-16 gb|EAZ06775.1| hypothetical protein OsI_29018 [Oryza sativa Indi... 84 5e-16 ref|XP_009415876.1| PREDICTED: pentatricopeptide repeat-containi... 84 5e-16 ref|XP_008646329.1| pentatricopeptide repeat-containing protein ... 83 7e-16 ref|XP_015648648.1| PREDICTED: pentatricopeptide repeat-containi... 83 9e-16 ref|XP_002450782.1| pentatricopeptide repeat-containing protein ... 82 2e-15 ref|XP_015056294.1| PREDICTED: pentatricopeptide repeat-containi... 81 3e-15 ref|XP_006366604.1| PREDICTED: pentatricopeptide repeat-containi... 81 4e-15 gb|PHT93174.1| Pentatricopeptide repeat-containing protein, mito... 81 4e-15 gb|PHU28856.1| Pentatricopeptide repeat-containing protein, mito... 81 4e-15 ref|XP_016557384.1| PREDICTED: pentatricopeptide repeat-containi... 81 4e-15 ref|XP_010327482.1| PREDICTED: pentatricopeptide repeat-containi... 80 6e-15 gb|EMS60949.1| hypothetical protein TRIUR3_17217 [Triticum urartu] 79 9e-15 dbj|BAK06692.1| predicted protein [Hordeum vulgare subsp. vulgare] 80 1e-14 ref|XP_020198303.1| pentatricopeptide repeat-containing protein ... 79 1e-14 ref|XP_016484176.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-14 ref|XP_009804649.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-14 ref|XP_022746243.1| pentatricopeptide repeat-containing protein ... 78 5e-14 >ref|XP_003577549.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like isoform X1 [Brachypodium distachyon] gb|PNT63622.1| hypothetical protein BRADI_4g18590v3 [Brachypodium distachyon] Length = 522 Score = 85.1 bits (209), Expect = 1e-16 Identities = 47/101 (46%), Positives = 60/101 (59%), Gaps = 1/101 (0%) Frame = -3 Query: 403 RRENLHLNQKAYAILIYGWC*SEPS*NGLEILEFDD*WWNRAKSGSI-YNVLLNGIYRRD 227 R+ N+K Y ILIYGWC + + N + D + + + YN+LLNG+ R Sbjct: 210 RKYKYEPNEKMYTILIYGWC--KVNRNDMSQKFLKDMIDHGIEPNVVTYNILLNGVCRHA 267 Query: 226 RLHPDT*FDMITREVEDLLNEIRSRGIEPEATSYAIVLHVY 104 LHPD FD R EDLL E+R RGIEP+ TSY+IVLHVY Sbjct: 268 SLHPDNRFDRTVRAAEDLLKEMRDRGIEPDVTSYSIVLHVY 308 >ref|XP_020110905.1| pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Ananas comosus] Length = 538 Score = 85.1 bits (209), Expect = 1e-16 Identities = 49/103 (47%), Positives = 63/103 (61%), Gaps = 3/103 (2%) Frame = -3 Query: 403 RRENLHLNQKAYAILIYGWC*SEPS*NGLEILE-FDD*WWNRAKSGSI--YNVLLNGIYR 233 R+ ++K Y+ILIYGWC N LE+ + F +R +I YN+LLNGI R Sbjct: 226 RKSKYEPDEKTYSILIYGWC----KVNQLEMAQKFLKEMTDRGVEPNIVTYNILLNGICR 281 Query: 232 RDRLHPDT*FDMITREVEDLLNEIRSRGIEPEATSYAIVLHVY 104 LHP+ FD R EDLL E+ SRGIEP+ TSY+I+LHVY Sbjct: 282 HASLHPENRFDRTIRAAEDLLKEMGSRGIEPDVTSYSIILHVY 324 >ref|XP_020695213.1| pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Dendrobium catenatum] gb|PKU71504.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 531 Score = 84.3 bits (207), Expect = 3e-16 Identities = 45/101 (44%), Positives = 65/101 (64%), Gaps = 2/101 (1%) Frame = -3 Query: 403 RRENLHLNQKAYAILIYGWC*SEPS*NGLEILEFDD*WWNRAKSGSI--YNVLLNGIYRR 230 R+ + ++KAY IL+YGWC + + + L+ R ++ YNVLLNGI RR Sbjct: 219 RKVSFEPDEKAYTILVYGWCKIKKTDMAQKFLKE---MIERGVELNVVTYNVLLNGICRR 275 Query: 229 DRLHPDT*FDMITREVEDLLNEIRSRGIEPEATSYAIVLHV 107 + LHPD FD E E+LL+++RSRGIEP+ TSY+I++HV Sbjct: 276 ESLHPDVCFDKTIHEAENLLSDMRSRGIEPDVTSYSIIIHV 316 >gb|EAZ06775.1| hypothetical protein OsI_29018 [Oryza sativa Indica Group] Length = 511 Score = 83.6 bits (205), Expect = 5e-16 Identities = 44/101 (43%), Positives = 60/101 (59%), Gaps = 1/101 (0%) Frame = -3 Query: 403 RRENLHLNQKAYAILIYGWC*SEPS*NGLEILEFDD*WWNRAKSGSI-YNVLLNGIYRRD 227 R+ N+K Y +LIYGWC + + N + D ++ + + YN+LLNGI R Sbjct: 199 RKYKYEPNEKMYTVLIYGWC--KVNRNDMAQKFLKDMIYHGIEPNIVTYNILLNGICRHA 256 Query: 226 RLHPDT*FDMITREVEDLLNEIRSRGIEPEATSYAIVLHVY 104 LHPD FD R EDLL E+ RGIEP+ TSY+++LHVY Sbjct: 257 SLHPDYRFDRTVRAAEDLLKEMHQRGIEPDVTSYSVILHVY 297 >ref|XP_009415876.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Musa acuminata subsp. malaccensis] Length = 531 Score = 83.6 bits (205), Expect = 5e-16 Identities = 46/96 (47%), Positives = 63/96 (65%), Gaps = 3/96 (3%) Frame = -3 Query: 382 NQKAYAILIYGWC*SEPS*NGLEILE-FDD*WWNRAKSGSI--YNVLLNGIYRRDRLHPD 212 ++K YAILIYGWC N E+ + F + +R ++ YN+LLNGI RR LHPD Sbjct: 226 DEKTYAILIYGWC----KVNRHEMAQRFLNEMVDRGLEPNVVTYNILLNGICRRASLHPD 281 Query: 211 T*FDMITREVEDLLNEIRSRGIEPEATSYAIVLHVY 104 FD + EDLLN++R++GIEP+ SY+I+LHVY Sbjct: 282 NRFDRTIQAAEDLLNQMRNKGIEPDTISYSIILHVY 317 Score = 55.8 bits (133), Expect = 2e-06 Identities = 44/122 (36%), Positives = 63/122 (51%), Gaps = 9/122 (7%) Frame = -1 Query: 342 KVNHHEMAWKFLNSMIDGGIEPNLVAYIMFC*MGSIGGTGCTQIPDLT**HVK*KIF*MR 163 KVN HEMA +FLN M+D G+EPN+V Y + G + L H + Sbjct: 239 KVNRHEMAQRFLNEMVDRGLEPNVVTYNILL-------NGICRRASL---HPDNRFDRTI 288 Query: 162 YAAEG--SSLRPRAM----LSFFMSM---AGAHKL*LMVIMFNSMKVRGICLMVDTYTSA 10 AAE + +R + + +S+ + + + AHK L + MF SMK +GIC V TYTS Sbjct: 289 QAAEDLLNQMRNKGIEPDTISYSIILHVYSRAHKPELSLYMFRSMKEKGICPTVATYTSL 348 Query: 9 IK 4 +K Sbjct: 349 VK 350 >ref|XP_008646329.1| pentatricopeptide repeat-containing protein At2g13420, mitochondrial [Zea mays] gb|AQK75297.1| Pentatricopeptide repeat-containing protein mitochondrial [Zea mays] Length = 526 Score = 83.2 bits (204), Expect = 7e-16 Identities = 46/94 (48%), Positives = 58/94 (61%), Gaps = 1/94 (1%) Frame = -3 Query: 382 NQKAYAILIYGWC*SEPS*NGLEILEFDD*WWNRAKSGSI-YNVLLNGIYRRDRLHPDT* 206 N+K Y+ILIYGWC S + L+ D + + + YN+LLNGI R LHPD Sbjct: 221 NEKMYSILIYGWCKVNRSDMAKKFLK--DMLVHGIEPNIVTYNILLNGICRHASLHPDYR 278 Query: 205 FDMITREVEDLLNEIRSRGIEPEATSYAIVLHVY 104 FD EDLL E+R RGIEP+ TSY+I+LHVY Sbjct: 279 FDRTVHAAEDLLKEMRGRGIEPDVTSYSIILHVY 312 >ref|XP_015648648.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial [Oryza sativa Japonica Group] dbj|BAF23568.1| Os08g0369200 [Oryza sativa Japonica Group] gb|EAZ42522.1| hypothetical protein OsJ_27088 [Oryza sativa Japonica Group] dbj|BAG97309.1| unnamed protein product [Oryza sativa Japonica Group] dbj|BAT05159.1| Os08g0369200 [Oryza sativa Japonica Group] Length = 511 Score = 82.8 bits (203), Expect = 9e-16 Identities = 44/101 (43%), Positives = 59/101 (58%), Gaps = 1/101 (0%) Frame = -3 Query: 403 RRENLHLNQKAYAILIYGWC*SEPS*NGLEILEFDD*WWNRAKSGSI-YNVLLNGIYRRD 227 R+ N+K Y +LIYGWC + + N + D ++ + + YN+LLNGI R Sbjct: 199 RKYKYEPNEKMYTVLIYGWC--KVNRNDMAQKFLKDMIYHGIEPNIVTYNILLNGICRHA 256 Query: 226 RLHPDT*FDMITREVEDLLNEIRSRGIEPEATSYAIVLHVY 104 LHPD FD R EDLL E+ RGIEP TSY+++LHVY Sbjct: 257 SLHPDYRFDRTVRAAEDLLKEMHQRGIEPNVTSYSVILHVY 297 >ref|XP_002450782.1| pentatricopeptide repeat-containing protein At2g13420, mitochondrial [Sorghum bicolor] gb|EES09770.1| hypothetical protein SORBI_3005G122700 [Sorghum bicolor] Length = 528 Score = 82.0 bits (201), Expect = 2e-15 Identities = 45/101 (44%), Positives = 60/101 (59%), Gaps = 1/101 (0%) Frame = -3 Query: 403 RRENLHLNQKAYAILIYGWC*SEPS*NGLEILEFDD*WWNRAKSGSI-YNVLLNGIYRRD 227 R+ + N+K Y ILIYGWC + + N + D + + + YN+LLNGI R Sbjct: 216 RKYKYNPNEKMYTILIYGWC--KVNRNDMARKFLKDMLDHGIEPNIVTYNILLNGICRHA 273 Query: 226 RLHPDT*FDMITREVEDLLNEIRSRGIEPEATSYAIVLHVY 104 LHPD FD ED+L E+R RGIEP+ TSY+I+LHVY Sbjct: 274 SLHPDYRFDRTVHSAEDVLKEMRDRGIEPDVTSYSIILHVY 314 >ref|XP_015056294.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Solanum pennellii] Length = 532 Score = 81.3 bits (199), Expect = 3e-15 Identities = 46/98 (46%), Positives = 58/98 (59%), Gaps = 2/98 (2%) Frame = -3 Query: 391 LHLNQKAYAILIYGWC*SEPS*NGLEILEFDD*WWNRAKSGSI--YNVLLNGIYRRDRLH 218 L LN K Y ILIYGWC + N F ++ ++ YNVLLNGI RR LH Sbjct: 225 LELNCKVYTILIYGWCKVK---NVEMARRFLGEMMDKGIDPNVVSYNVLLNGICRRASLH 281 Query: 217 PDT*FDMITREVEDLLNEIRSRGIEPEATSYAIVLHVY 104 PD FD + RE E + E+ RG+EP+ TSY+I+LHVY Sbjct: 282 PDGRFDKVIREAEKVFEEMTERGVEPDGTSYSILLHVY 319 >ref|XP_006366604.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Solanum tuberosum] ref|XP_006366605.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Solanum tuberosum] ref|XP_006366606.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Solanum tuberosum] ref|XP_015160458.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Solanum tuberosum] ref|XP_015160459.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Solanum tuberosum] Length = 520 Score = 80.9 bits (198), Expect = 4e-15 Identities = 46/98 (46%), Positives = 58/98 (59%), Gaps = 2/98 (2%) Frame = -3 Query: 391 LHLNQKAYAILIYGWC*SEPS*NGLEILEFDD*WWNRAKSGSI--YNVLLNGIYRRDRLH 218 L LN K Y ILIYGWC + N F ++ ++ YNVLLNGI RR LH Sbjct: 213 LELNCKVYTILIYGWCKVK---NVEMARRFLGEMLDKGIDPNVVSYNVLLNGICRRASLH 269 Query: 217 PDT*FDMITREVEDLLNEIRSRGIEPEATSYAIVLHVY 104 PD FD + RE E + E+ RG+EP+ TSY+I+LHVY Sbjct: 270 PDGRFDKVIREAEKVFEEMTERGVEPDVTSYSILLHVY 307 >gb|PHT93174.1| Pentatricopeptide repeat-containing protein, mitochondrial [Capsicum annuum] Length = 521 Score = 80.9 bits (198), Expect = 4e-15 Identities = 46/102 (45%), Positives = 57/102 (55%), Gaps = 6/102 (5%) Frame = -3 Query: 391 LHLNQKAYAILIYGWC*SEPS*NGLEILEFDD*WWNRAKSGSI------YNVLLNGIYRR 230 L LN K Y ILIYGWC ++ +E + I YNVLLNGI RR Sbjct: 214 LELNCKVYTILIYGWC-------KVKNIEMARRFLGEMLDKGIDPNVVSYNVLLNGICRR 266 Query: 229 DRLHPDT*FDMITREVEDLLNEIRSRGIEPEATSYAIVLHVY 104 LHPD FD + RE E + E+ RG+EP+ TSY+I+LHVY Sbjct: 267 ASLHPDGRFDKVIREAEKVFKEMTERGVEPDVTSYSILLHVY 308 >gb|PHU28856.1| Pentatricopeptide repeat-containing protein, mitochondrial [Capsicum chinense] Length = 522 Score = 80.9 bits (198), Expect = 4e-15 Identities = 46/102 (45%), Positives = 57/102 (55%), Gaps = 6/102 (5%) Frame = -3 Query: 391 LHLNQKAYAILIYGWC*SEPS*NGLEILEFDD*WWNRAKSGSI------YNVLLNGIYRR 230 L LN K Y ILIYGWC ++ +E + I YNVLLNGI RR Sbjct: 215 LELNCKVYTILIYGWC-------KVKNIEMARRFLGEMLDKGIDPNVVSYNVLLNGICRR 267 Query: 229 DRLHPDT*FDMITREVEDLLNEIRSRGIEPEATSYAIVLHVY 104 LHPD FD + RE E + E+ RG+EP+ TSY+I+LHVY Sbjct: 268 ASLHPDGRFDKVIREAEKVFKEMTERGVEPDVTSYSILLHVY 309 >ref|XP_016557384.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Capsicum annuum] Length = 522 Score = 80.9 bits (198), Expect = 4e-15 Identities = 46/102 (45%), Positives = 57/102 (55%), Gaps = 6/102 (5%) Frame = -3 Query: 391 LHLNQKAYAILIYGWC*SEPS*NGLEILEFDD*WWNRAKSGSI------YNVLLNGIYRR 230 L LN K Y ILIYGWC ++ +E + I YNVLLNGI RR Sbjct: 215 LELNCKVYTILIYGWC-------KVKNIEMARRFLGEMLDKGIDPNVVSYNVLLNGICRR 267 Query: 229 DRLHPDT*FDMITREVEDLLNEIRSRGIEPEATSYAIVLHVY 104 LHPD FD + RE E + E+ RG+EP+ TSY+I+LHVY Sbjct: 268 ASLHPDGRFDKVIREAEKVFKEMTERGVEPDVTSYSILLHVY 309 >ref|XP_010327482.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Solanum lycopersicum] ref|XP_010327483.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Solanum lycopersicum] Length = 532 Score = 80.5 bits (197), Expect = 6e-15 Identities = 46/101 (45%), Positives = 59/101 (58%), Gaps = 2/101 (1%) Frame = -3 Query: 391 LHLNQKAYAILIYGWC*SEPS*NGLEILEFDD*WWNRAKSGSI--YNVLLNGIYRRDRLH 218 L LN K Y IL+YGWC + N F ++ ++ YNVLLNGI RR LH Sbjct: 225 LELNCKVYTILMYGWCKVK---NVEMARRFLGEMMDKGIDPNVVSYNVLLNGICRRASLH 281 Query: 217 PDT*FDMITREVEDLLNEIRSRGIEPEATSYAIVLHVYGWS 95 PD FD + RE E + E+ RG+EP+ TSY+I+LHVY S Sbjct: 282 PDGRFDKVIREAEKVFEEMTERGVEPDVTSYSILLHVYSRS 322 >gb|EMS60949.1| hypothetical protein TRIUR3_17217 [Triticum urartu] Length = 349 Score = 79.3 bits (194), Expect = 9e-15 Identities = 45/100 (45%), Positives = 56/100 (56%) Frame = -3 Query: 403 RRENLHLNQKAYAILIYGWC*SEPS*NGLEILEFDD*WWNRAKSGSIYNVLLNGIYRRDR 224 R+ N+K Y ILIYGWC S + L+ D + YN+LLNGI R Sbjct: 37 RKYKYEPNEKMYTILIYGWCKVNRSDMSQKFLK-DMIDHGIEPNIVTYNILLNGICRHAS 95 Query: 223 LHPDT*FDMITREVEDLLNEIRSRGIEPEATSYAIVLHVY 104 LHPD FD E+LL E+ RGIEP+ TSY+I+LHVY Sbjct: 96 LHPDNRFDRTVNAAENLLKEMSDRGIEPDVTSYSIILHVY 135 >dbj|BAK06692.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 522 Score = 79.7 bits (195), Expect = 1e-14 Identities = 45/100 (45%), Positives = 56/100 (56%) Frame = -3 Query: 403 RRENLHLNQKAYAILIYGWC*SEPS*NGLEILEFDD*WWNRAKSGSIYNVLLNGIYRRDR 224 R+ N+K Y ILIYGWC S + L+ D + YN+LLNGI R Sbjct: 210 RKYKYEPNEKMYTILIYGWCKVNRSDMAQKFLK-DMIDHGIEPNIVTYNILLNGICRHAS 268 Query: 223 LHPDT*FDMITREVEDLLNEIRSRGIEPEATSYAIVLHVY 104 LHPD FD E+LL E+ RGIEP+ TSY+I+LHVY Sbjct: 269 LHPDNRFDRTVNAAENLLKEMNDRGIEPDVTSYSIILHVY 308 >ref|XP_020198303.1| pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Aegilops tauschii subsp. tauschii] Length = 522 Score = 79.3 bits (194), Expect = 1e-14 Identities = 45/100 (45%), Positives = 56/100 (56%) Frame = -3 Query: 403 RRENLHLNQKAYAILIYGWC*SEPS*NGLEILEFDD*WWNRAKSGSIYNVLLNGIYRRDR 224 R+ N+K Y ILIYGWC S + L+ D + YN+LLNGI R Sbjct: 210 RKYKYEPNEKMYTILIYGWCKVNRSDMSQKFLK-DMIDHGIEPNLVTYNILLNGICRHAS 268 Query: 223 LHPDT*FDMITREVEDLLNEIRSRGIEPEATSYAIVLHVY 104 LHPD FD E+LL E+ RGIEP+ TSY+I+LHVY Sbjct: 269 LHPDNRFDRTVNAAENLLKEMSDRGIEPDVTSYSIILHVY 308 >ref|XP_016484176.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Nicotiana tabacum] Length = 530 Score = 79.3 bits (194), Expect = 1e-14 Identities = 44/98 (44%), Positives = 59/98 (60%), Gaps = 2/98 (2%) Frame = -3 Query: 391 LHLNQKAYAILIYGWC*SEPS*NGLEILEFDD*WWNRAKSGSI--YNVLLNGIYRRDRLH 218 L LN+K Y ILIYGWC + N F + ++ YNVLLNGI RR LH Sbjct: 223 LELNRKIYTILIYGWCKVK---NIDMARRFLGEMLEKGIDPNVVSYNVLLNGICRRASLH 279 Query: 217 PDT*FDMITREVEDLLNEIRSRGIEPEATSYAIVLHVY 104 P+ F+ + RE E L +E+ RG+EP+ TSY+++LHVY Sbjct: 280 PEERFEKVIREAEKLFDEMTERGVEPDVTSYSVLLHVY 317 >ref|XP_009804649.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Nicotiana sylvestris] Length = 530 Score = 79.3 bits (194), Expect = 1e-14 Identities = 44/98 (44%), Positives = 59/98 (60%), Gaps = 2/98 (2%) Frame = -3 Query: 391 LHLNQKAYAILIYGWC*SEPS*NGLEILEFDD*WWNRAKSGSI--YNVLLNGIYRRDRLH 218 L LN+K Y ILIYGWC + N F + ++ YNVLLNGI RR LH Sbjct: 223 LELNRKIYTILIYGWCKVK---NIDMARRFLGEMLEKGIDPNVVSYNVLLNGICRRASLH 279 Query: 217 PDT*FDMITREVEDLLNEIRSRGIEPEATSYAIVLHVY 104 P+ F+ + RE E L +E+ RG+EP+ TSY+++LHVY Sbjct: 280 PEERFEKVIREAEKLFDEMTERGVEPDVTSYSVLLHVY 317 >ref|XP_022746243.1| pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Durio zibethinus] Length = 532 Score = 77.8 bits (190), Expect = 5e-14 Identities = 46/103 (44%), Positives = 58/103 (56%), Gaps = 3/103 (2%) Frame = -3 Query: 403 RRENLHLNQKAYAILIYGWC*SEPS*NGLEILE-FDD*WWNRAKSGSI--YNVLLNGIYR 233 R+ ++ K Y ILI GWC ++ E F R ++ YNV+LNGI R Sbjct: 221 RKSGFRVDSKMYTILISGWC----KIGRIDKAERFLTEMIERGMEPNVVTYNVMLNGICR 276 Query: 232 RDRLHPDT*FDMITREVEDLLNEIRSRGIEPEATSYAIVLHVY 104 R LHPD FD R E L NE+R RGIEP+ TS++IVLHVY Sbjct: 277 RASLHPDERFDRTIRNAEKLFNEMRQRGIEPDVTSFSIVLHVY 319