BLASTX nr result
ID: Ophiopogon27_contig00036239
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00036239 (531 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020243738.1| pentatricopeptide repeat-containing protein ... 56 5e-06 >ref|XP_020243738.1| pentatricopeptide repeat-containing protein At5g66520-like [Asparagus officinalis] Length = 436 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/56 (46%), Positives = 34/56 (60%) Frame = +2 Query: 362 YLTFPSLVKCCSHHRIYVIGQALHSHIFNFDHHCNTFIQRSLIFMYYTSVHIMLTR 529 +LTFP L+K CS H +V G+ALHSHIF + +I SL+FMY + L R Sbjct: 10 HLTFPFLLKSCSLHHAHVTGRALHSHIFRLGFVADVYINNSLVFMYSACGQVELAR 65