BLASTX nr result
ID: Ophiopogon27_contig00036196
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00036196 (485 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020272320.1| uncharacterized protein LOC109847501 [Aspara... 53 2e-11 >ref|XP_020272320.1| uncharacterized protein LOC109847501 [Asparagus officinalis] gb|ONK79155.1| uncharacterized protein A4U43_C01F3490 [Asparagus officinalis] Length = 306 Score = 53.1 bits (126), Expect(2) = 2e-11 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 255 NKEKQTSRKVQQTSGLLKDIRSLRARVASVIKAQIDDK 142 +++KQ + KVQQTSGLLKDI S+R RVAS+IKAQ D K Sbjct: 258 SEQKQMNTKVQQTSGLLKDIHSIRERVASIIKAQTDRK 295 Score = 43.1 bits (100), Expect(2) = 2e-11 Identities = 21/38 (55%), Positives = 30/38 (78%) Frame = -1 Query: 353 STREVFLQYVDGQLQTVESVLVMFLKLSTLMFEIKKSR 240 S+ E FLQYVDG+LQ VES L MFL++STL+ + ++ + Sbjct: 225 SSYEEFLQYVDGKLQQVESELDMFLRVSTLILDSEQKQ 262