BLASTX nr result
ID: Ophiopogon27_contig00035882
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00035882 (603 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020256721.1| anthocyanidin 3-O-glucosyltransferase 2-like... 80 5e-14 >ref|XP_020256721.1| anthocyanidin 3-O-glucosyltransferase 2-like [Asparagus officinalis] gb|ONK74914.1| uncharacterized protein A4U43_C03F11410 [Asparagus officinalis] Length = 473 Score = 80.1 bits (196), Expect = 5e-14 Identities = 40/62 (64%), Positives = 47/62 (75%), Gaps = 1/62 (1%) Frame = +3 Query: 120 MAKIAVMFMPTPGIGHLISTMELAKLL-KYPNGHFSVTVLTMRHFFPAWASAITAYVRSS 296 M KI VMFMP G+GHLIST+ELAKLL K HFS+T+LT+ H PAWASAI AY+ S Sbjct: 1 MVKIGVMFMPIQGVGHLISTVELAKLLLKNTEIHFSITILTINHLVPAWASAIKAYIDSV 60 Query: 297 VS 302 +S Sbjct: 61 IS 62