BLASTX nr result
ID: Ophiopogon27_contig00035540
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00035540 (321 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO43853.1| hypothetical protein CISIN_1g0409871mg, partial [... 76 3e-16 gb|ONK64951.1| uncharacterized protein A4U43_C07F31790 [Asparagu... 83 3e-16 ref|XP_010904674.1| PREDICTED: WD repeat-containing protein 75 i... 83 3e-16 ref|XP_010904672.1| PREDICTED: WD repeat-containing protein 75 i... 83 3e-16 gb|PKI46390.1| hypothetical protein CRG98_033228, partial [Punic... 79 8e-16 gb|ONM02048.1| Transducin/WD40 repeat-like superfamily protein [... 80 2e-15 gb|ACN31837.1| unknown [Zea mays] >gi|1142632980|gb|ONM02043.1| ... 80 2e-15 gb|ONM02047.1| Transducin/WD40 repeat-like superfamily protein [... 80 2e-15 gb|PAN21831.1| hypothetical protein PAHAL_C04700 [Panicum hallii] 80 2e-15 ref|NP_001316395.1| uncharacterized protein LOC100383022 [Zea ma... 80 2e-15 gb|PIA62118.1| hypothetical protein AQUCO_00200250v1 [Aquilegia ... 80 2e-15 gb|ONM02044.1| Transducin/WD40 repeat-like superfamily protein [... 80 2e-15 ref|XP_020092272.1| WD repeat-containing protein 75 [Ananas como... 80 4e-15 gb|OMO71724.1| hypothetical protein CCACVL1_18085 [Corchorus cap... 79 6e-15 gb|OMO51290.1| hypothetical protein COLO4_37741 [Corchorus olito... 79 6e-15 gb|OMO60725.1| hypothetical protein CCACVL1_23917 [Corchorus cap... 79 6e-15 gb|OEL33451.1| WD repeat-containing protein 75 [Dichanthelium ol... 79 8e-15 gb|OWM87006.1| hypothetical protein CDL15_Pgr016043 [Punica gran... 79 1e-14 ref|XP_003577564.1| PREDICTED: WD repeat-containing protein 75 [... 79 1e-14 ref|XP_002442502.1| WD repeat-containing protein 75 [Sorghum bic... 79 1e-14 >gb|KDO43853.1| hypothetical protein CISIN_1g0409871mg, partial [Citrus sinensis] Length = 67 Score = 76.3 bits (186), Expect = 3e-16 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 319 PFMPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRPSTVE 191 P +PSE+PWETIFSGSSH LPPLTKLCSAFLESLLEKR + +E Sbjct: 25 PSVPSEKPWETIFSGSSHNLPPLTKLCSAFLESLLEKRTAALE 67 >gb|ONK64951.1| uncharacterized protein A4U43_C07F31790 [Asparagus officinalis] Length = 773 Score = 82.8 bits (203), Expect = 3e-16 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 319 PFMPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRPSTVE 191 PF+PSERPWETIFSGSSHVLPPLTKLCSAFL SLLEKR +T+E Sbjct: 731 PFVPSERPWETIFSGSSHVLPPLTKLCSAFLSSLLEKRHTTLE 773 >ref|XP_010904674.1| PREDICTED: WD repeat-containing protein 75 isoform X2 [Elaeis guineensis] Length = 806 Score = 82.8 bits (203), Expect = 3e-16 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 319 PFMPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRPSTVE 191 PF+PSERPWETIFSGSSHVLPPLTKLCSAFL SLLEK+PS+ E Sbjct: 764 PFVPSERPWETIFSGSSHVLPPLTKLCSAFLTSLLEKKPSSNE 806 >ref|XP_010904672.1| PREDICTED: WD repeat-containing protein 75 isoform X1 [Elaeis guineensis] Length = 812 Score = 82.8 bits (203), Expect = 3e-16 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 319 PFMPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRPSTVE 191 PF+PSERPWETIFSGSSHVLPPLTKLCSAFL SLLEK+PS+ E Sbjct: 770 PFVPSERPWETIFSGSSHVLPPLTKLCSAFLTSLLEKKPSSNE 812 >gb|PKI46390.1| hypothetical protein CRG98_033228, partial [Punica granatum] Length = 189 Score = 78.6 bits (192), Expect = 8e-16 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -3 Query: 313 MPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRPSTVE 191 +PSERPWETIFSGSSH LPPLTKLC+AFLESLLEKRP+ VE Sbjct: 147 VPSERPWETIFSGSSHNLPPLTKLCAAFLESLLEKRPAAVE 187 >gb|ONM02048.1| Transducin/WD40 repeat-like superfamily protein [Zea mays] Length = 379 Score = 80.5 bits (197), Expect = 2e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 319 PFMPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRP 203 PF+PS+RPWETIFSGSSHVLPPLTKLCSAFL SLLEKRP Sbjct: 337 PFVPSDRPWETIFSGSSHVLPPLTKLCSAFLSSLLEKRP 375 >gb|ACN31837.1| unknown [Zea mays] gb|ONM02043.1| Transducin/WD40 repeat-like superfamily protein [Zea mays] gb|ONM02046.1| Transducin/WD40 repeat-like superfamily protein [Zea mays] gb|ONM02050.1| Transducin/WD40 repeat-like superfamily protein [Zea mays] Length = 455 Score = 80.5 bits (197), Expect = 2e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 319 PFMPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRP 203 PF+PS+RPWETIFSGSSHVLPPLTKLCSAFL SLLEKRP Sbjct: 413 PFVPSDRPWETIFSGSSHVLPPLTKLCSAFLSSLLEKRP 451 >gb|ONM02047.1| Transducin/WD40 repeat-like superfamily protein [Zea mays] Length = 793 Score = 80.5 bits (197), Expect = 2e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 319 PFMPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRP 203 PF+PS+RPWETIFSGSSHVLPPLTKLCSAFL SLLEKRP Sbjct: 751 PFVPSDRPWETIFSGSSHVLPPLTKLCSAFLSSLLEKRP 789 >gb|PAN21831.1| hypothetical protein PAHAL_C04700 [Panicum hallii] Length = 794 Score = 80.5 bits (197), Expect = 2e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 319 PFMPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRP 203 PF+PS+RPWETIFSGSSHVLPPLTKLCSAFL SLLEKRP Sbjct: 752 PFIPSDRPWETIFSGSSHVLPPLTKLCSAFLSSLLEKRP 790 >ref|NP_001316395.1| uncharacterized protein LOC100383022 [Zea mays] gb|ONM02045.1| Transducin/WD40 repeat-like superfamily protein [Zea mays] Length = 800 Score = 80.5 bits (197), Expect = 2e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 319 PFMPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRP 203 PF+PS+RPWETIFSGSSHVLPPLTKLCSAFL SLLEKRP Sbjct: 758 PFVPSDRPWETIFSGSSHVLPPLTKLCSAFLSSLLEKRP 796 >gb|PIA62118.1| hypothetical protein AQUCO_00200250v1 [Aquilegia coerulea] Length = 813 Score = 80.5 bits (197), Expect = 2e-15 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = -3 Query: 319 PFMPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRPSTVE 191 PF+PSERPWETIFSGSSHVLPPLTKLCS FLESLLEK P+ E Sbjct: 771 PFVPSERPWETIFSGSSHVLPPLTKLCSVFLESLLEKLPAIQE 813 >gb|ONM02044.1| Transducin/WD40 repeat-like superfamily protein [Zea mays] Length = 817 Score = 80.5 bits (197), Expect = 2e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 319 PFMPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRP 203 PF+PS+RPWETIFSGSSHVLPPLTKLCSAFL SLLEKRP Sbjct: 775 PFVPSDRPWETIFSGSSHVLPPLTKLCSAFLSSLLEKRP 813 >ref|XP_020092272.1| WD repeat-containing protein 75 [Ananas comosus] gb|OAY64962.1| WD repeat-containing protein 75 [Ananas comosus] Length = 807 Score = 79.7 bits (195), Expect = 4e-15 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -3 Query: 319 PFMPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRP 203 PF+PSERPWETIFSGSSHVLPPLTKLCS FL SLLEKRP Sbjct: 763 PFVPSERPWETIFSGSSHVLPPLTKLCSTFLASLLEKRP 801 >gb|OMO71724.1| hypothetical protein CCACVL1_18085 [Corchorus capsularis] Length = 789 Score = 79.3 bits (194), Expect = 6e-15 Identities = 37/43 (86%), Positives = 38/43 (88%) Frame = -3 Query: 319 PFMPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRPSTVE 191 P PSERPWETIFSGSSH LPPLTKLCSAFLESLLEKR + VE Sbjct: 747 PSFPSERPWETIFSGSSHALPPLTKLCSAFLESLLEKRTAAVE 789 >gb|OMO51290.1| hypothetical protein COLO4_37741 [Corchorus olitorius] Length = 805 Score = 79.3 bits (194), Expect = 6e-15 Identities = 37/43 (86%), Positives = 38/43 (88%) Frame = -3 Query: 319 PFMPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRPSTVE 191 P PSERPWETIFSGSSH LPPLTKLCSAFLESLLEKR + VE Sbjct: 763 PSFPSERPWETIFSGSSHALPPLTKLCSAFLESLLEKRTAAVE 805 >gb|OMO60725.1| hypothetical protein CCACVL1_23917 [Corchorus capsularis] Length = 810 Score = 79.3 bits (194), Expect = 6e-15 Identities = 37/43 (86%), Positives = 38/43 (88%) Frame = -3 Query: 319 PFMPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRPSTVE 191 P PSERPWETIFSGSSH LPPLTKLCSAFLESLLEKR + VE Sbjct: 768 PSFPSERPWETIFSGSSHALPPLTKLCSAFLESLLEKRTAAVE 810 >gb|OEL33451.1| WD repeat-containing protein 75 [Dichanthelium oligosanthes] Length = 802 Score = 79.0 bits (193), Expect = 8e-15 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -3 Query: 319 PFMPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRP 203 PF+PS+RPWETIFSGSSH LPPLTKLCSAFL SLLEKRP Sbjct: 760 PFVPSDRPWETIFSGSSHALPPLTKLCSAFLSSLLEKRP 798 >gb|OWM87006.1| hypothetical protein CDL15_Pgr016043 [Punica granatum] Length = 785 Score = 78.6 bits (192), Expect = 1e-14 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -3 Query: 313 MPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRPSTVE 191 +PSERPWETIFSGSSH LPPLTKLC+AFLESLLEKRP+ VE Sbjct: 743 VPSERPWETIFSGSSHNLPPLTKLCAAFLESLLEKRPAAVE 783 >ref|XP_003577564.1| PREDICTED: WD repeat-containing protein 75 [Brachypodium distachyon] gb|KQJ85864.1| hypothetical protein BRADI_4g02100v3 [Brachypodium distachyon] Length = 793 Score = 78.6 bits (192), Expect = 1e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -3 Query: 319 PFMPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRP 203 PF+PSERPWETIF+GSSHVLPPLTKLCS FL SLLEKRP Sbjct: 751 PFIPSERPWETIFTGSSHVLPPLTKLCSVFLASLLEKRP 789 >ref|XP_002442502.1| WD repeat-containing protein 75 [Sorghum bicolor] gb|EES16340.1| hypothetical protein SORBI_3008G163500 [Sorghum bicolor] Length = 799 Score = 78.6 bits (192), Expect = 1e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -3 Query: 319 PFMPSERPWETIFSGSSHVLPPLTKLCSAFLESLLEKRP 203 PF+PS+RPWETIFSGSSHVLPPLTKLCSAFL SLLE RP Sbjct: 757 PFIPSDRPWETIFSGSSHVLPPLTKLCSAFLSSLLENRP 795