BLASTX nr result
ID: Ophiopogon27_contig00034998
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00034998 (570 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK67529.1| uncharacterized protein A4U43_C05F990 [Asparagus ... 62 1e-09 ref|XP_020267943.1| bidirectional sugar transporter SWEET12-like... 62 1e-09 >gb|ONK67529.1| uncharacterized protein A4U43_C05F990 [Asparagus officinalis] Length = 507 Score = 61.6 bits (148), Expect(2) = 1e-09 Identities = 38/69 (55%), Positives = 41/69 (59%), Gaps = 5/69 (7%) Frame = -1 Query: 354 GFLFGMVQMIVYFIYMNVKKDH-----TEVVDMHPTRTSEIEVVDMKNVVEHLAMGTEKA 190 GFLFGM QMI+YFIYMN KD TEVV +HPTR SEIEV+ EK Sbjct: 452 GFLFGMAQMILYFIYMNKNKDEPVPNLTEVVHVHPTRNSEIEVIH----------NNEK- 500 Query: 189 MPEAPRPET 163 EA RPET Sbjct: 501 --EAARPET 507 Score = 28.9 bits (63), Expect(2) = 1e-09 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -2 Query: 569 EYMPXXXXXXXXXXXXXXXWYGLLMKDFFIAVSSQM 462 EYMP YGLL+KDFF+A + M Sbjct: 416 EYMPFSLSFFLTLSALAWFCYGLLLKDFFVAFPNVM 451 >ref|XP_020267943.1| bidirectional sugar transporter SWEET12-like [Asparagus officinalis] ref|XP_020267944.1| bidirectional sugar transporter SWEET12-like [Asparagus officinalis] Length = 254 Score = 61.6 bits (148), Expect(2) = 1e-09 Identities = 38/69 (55%), Positives = 41/69 (59%), Gaps = 5/69 (7%) Frame = -1 Query: 354 GFLFGMVQMIVYFIYMNVKKDH-----TEVVDMHPTRTSEIEVVDMKNVVEHLAMGTEKA 190 GFLFGM QMI+YFIYMN KD TEVV +HPTR SEIEV+ EK Sbjct: 199 GFLFGMAQMILYFIYMNKNKDEPVPNLTEVVHVHPTRNSEIEVIH----------NNEK- 247 Query: 189 MPEAPRPET 163 EA RPET Sbjct: 248 --EAARPET 254 Score = 28.9 bits (63), Expect(2) = 1e-09 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -2 Query: 569 EYMPXXXXXXXXXXXXXXXWYGLLMKDFFIAVSSQM 462 EYMP YGLL+KDFF+A + M Sbjct: 163 EYMPFSLSFFLTLSALAWFCYGLLLKDFFVAFPNVM 198