BLASTX nr result
ID: Ophiopogon27_contig00034835
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00034835 (540 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK63667.1| uncharacterized protein A4U43_C07F17640 [Asparagu... 66 3e-09 ref|XP_020275296.1| LOW QUALITY PROTEIN: 65-kDa microtubule-asso... 66 3e-09 ref|XP_022764685.1| 65-kDa microtubule-associated protein 5 isof... 64 2e-08 ref|XP_022764684.1| 65-kDa microtubule-associated protein 5 isof... 64 2e-08 ref|XP_008795133.1| PREDICTED: 65-kDa microtubule-associated pro... 62 8e-08 ref|XP_010909304.2| PREDICTED: 65-kDa microtubule-associated pro... 61 1e-07 ref|XP_017984152.1| PREDICTED: 65-kDa microtubule-associated pro... 60 2e-07 gb|EOY19590.1| 65-kDa microtubule-associated protein 5 isoform 1... 60 2e-07 ref|XP_021296541.1| 65-kDa microtubule-associated protein 5 [Her... 59 9e-07 ref|XP_009417899.1| PREDICTED: 65-kDa microtubule-associated pro... 59 9e-07 ref|XP_016699835.1| PREDICTED: 65-kDa microtubule-associated pro... 57 3e-06 ref|XP_012457055.1| PREDICTED: 65-kDa microtubule-associated pro... 57 3e-06 gb|OMO88283.1| hypothetical protein CCACVL1_08490, partial [Corc... 53 3e-06 gb|PPD72363.1| hypothetical protein GOBAR_DD30728 [Gossypium bar... 54 6e-06 ref|XP_008231710.1| PREDICTED: 65-kDa microtubule-associated pro... 56 6e-06 ref|XP_007221047.1| 65-kDa microtubule-associated protein 5 [Pru... 56 6e-06 ref|XP_004308670.1| PREDICTED: 65-kDa microtubule-associated pro... 56 6e-06 ref|XP_017616864.1| PREDICTED: 65-kDa microtubule-associated pro... 56 8e-06 >gb|ONK63667.1| uncharacterized protein A4U43_C07F17640 [Asparagus officinalis] Length = 467 Score = 65.9 bits (159), Expect = 3e-09 Identities = 35/49 (71%), Positives = 39/49 (79%), Gaps = 2/49 (4%) Frame = -3 Query: 538 MAGTPISRRVSTPFPRHGIISSSVKEKKG--SKAVAATTPVNYVSLPKD 398 +AGTP SRRVSTPFPRHG++SS K+KK KAV A PVNYVSLPKD Sbjct: 419 IAGTPTSRRVSTPFPRHGLMSSG-KDKKDYRGKAVGAIMPVNYVSLPKD 466 >ref|XP_020275296.1| LOW QUALITY PROTEIN: 65-kDa microtubule-associated protein 5-like [Asparagus officinalis] Length = 567 Score = 65.9 bits (159), Expect = 3e-09 Identities = 35/49 (71%), Positives = 39/49 (79%), Gaps = 2/49 (4%) Frame = -3 Query: 538 MAGTPISRRVSTPFPRHGIISSSVKEKKG--SKAVAATTPVNYVSLPKD 398 +AGTP SRRVSTPFPRHG++SS K+KK KAV A PVNYVSLPKD Sbjct: 519 IAGTPTSRRVSTPFPRHGLMSSG-KDKKDYRGKAVGAIMPVNYVSLPKD 566 >ref|XP_022764685.1| 65-kDa microtubule-associated protein 5 isoform X2 [Durio zibethinus] Length = 565 Score = 63.5 bits (153), Expect = 2e-08 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -3 Query: 538 MAGTPISRRVSTPFPRHGIISSSVKEKKGSKAVAATTPVNYVSLPKDDALSR 383 MAGTPISRRVSTP RHG+ SS+KE++ S V P+N+V+LPKDD++SR Sbjct: 514 MAGTPISRRVSTPSGRHGV--SSLKERRESARVNNVIPLNFVALPKDDSVSR 563 >ref|XP_022764684.1| 65-kDa microtubule-associated protein 5 isoform X1 [Durio zibethinus] Length = 566 Score = 63.5 bits (153), Expect = 2e-08 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -3 Query: 538 MAGTPISRRVSTPFPRHGIISSSVKEKKGSKAVAATTPVNYVSLPKDDALSR 383 MAGTPISRRVSTP RHG+ SS+KE++ S V P+N+V+LPKDD++SR Sbjct: 515 MAGTPISRRVSTPSGRHGV--SSLKERRESARVNNVIPLNFVALPKDDSVSR 564 >ref|XP_008795133.1| PREDICTED: 65-kDa microtubule-associated protein 5-like [Phoenix dactylifera] Length = 582 Score = 61.6 bits (148), Expect = 8e-08 Identities = 32/59 (54%), Positives = 40/59 (67%) Frame = -3 Query: 538 MAGTPISRRVSTPFPRHGIISSSVKEKKGSKAVAATTPVNYVSLPKDDALSRITPVVSP 362 ++GTP SRRVSTP RHG ISSS K+K+ A PVN+V+LPKDD + +VSP Sbjct: 525 VSGTPTSRRVSTPLARHG-ISSSSKDKRECGKKTAMVPVNFVALPKDDPTQNNSAIVSP 582 >ref|XP_010909304.2| PREDICTED: 65-kDa microtubule-associated protein 5 isoform X1 [Elaeis guineensis] Length = 583 Score = 61.2 bits (147), Expect = 1e-07 Identities = 35/58 (60%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = -3 Query: 532 GTPISRRVSTPFPRHGIISSSVKEKKGSKAVAATTPVNYVSLPKDDAL-SRITPVVSP 362 GTPI RRVSTP RHG IS S K+KK S A PVNYV+LPKDD+L + +VSP Sbjct: 527 GTPIGRRVSTPLARHG-ISLSSKDKKESGKKTAMIPVNYVALPKDDSLPQNNSAIVSP 583 >ref|XP_017984152.1| PREDICTED: 65-kDa microtubule-associated protein 5 [Theobroma cacao] Length = 565 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -3 Query: 538 MAGTPISRRVSTPFPRHGIISSSVKEKKGSKAVAATTPVNYVSLPKDDALSR 383 M GTPI RRVSTP RHG+ SS+KE++ S V P+N+V+LPKDD++SR Sbjct: 514 MVGTPIGRRVSTPSSRHGV--SSLKERRESGRVNNVIPLNFVALPKDDSVSR 563 >gb|EOY19590.1| 65-kDa microtubule-associated protein 5 isoform 1 [Theobroma cacao] Length = 565 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -3 Query: 538 MAGTPISRRVSTPFPRHGIISSSVKEKKGSKAVAATTPVNYVSLPKDDALSR 383 M GTPI RRVSTP RHG+ SS+KE++ S V P+N+V+LPKDD++SR Sbjct: 514 MVGTPIGRRVSTPSSRHGV--SSLKERRESGRVNNVIPLNFVALPKDDSVSR 563 >ref|XP_021296541.1| 65-kDa microtubule-associated protein 5 [Herrania umbratica] Length = 565 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = -3 Query: 538 MAGTPISRRVSTPFPRHGIISSSVKEKKGSKAVAATTPVNYVSLPKDDALSR 383 M GTP+ RRVSTP RHG+ SS+KE + S V P+N+V+LPKDD++SR Sbjct: 514 MVGTPVGRRVSTPSGRHGV--SSLKEHRESGRVNNVIPLNFVALPKDDSVSR 563 >ref|XP_009417899.1| PREDICTED: 65-kDa microtubule-associated protein 5 [Musa acuminata subsp. malaccensis] Length = 581 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/55 (58%), Positives = 39/55 (70%) Frame = -3 Query: 532 GTPISRRVSTPFPRHGIISSSVKEKKGSKAVAATTPVNYVSLPKDDALSRITPVV 368 GTP RRVSTPF R GI+SS KEKKG K + TP NYVSL KDD++S + ++ Sbjct: 529 GTPTGRRVSTPFGRQGIMSSG-KEKKGGKG-SVVTPDNYVSLQKDDSVSHNSSIL 581 >ref|XP_016699835.1| PREDICTED: 65-kDa microtubule-associated protein 5 [Gossypium hirsutum] Length = 565 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = -3 Query: 538 MAGTPISRRVSTPFPRHGIISSSVKEKKGSKAVAATTPVNYVSLPKDDALSR 383 M GTP SRRVSTP +HG+ S++KE++ + V PVN+V+LPKDD +SR Sbjct: 514 MVGTPTSRRVSTPSGKHGV--SNLKERRETGRVNNVIPVNFVALPKDDPMSR 563 >ref|XP_012457055.1| PREDICTED: 65-kDa microtubule-associated protein 5 [Gossypium raimondii] gb|KJB73204.1| hypothetical protein B456_011G221700 [Gossypium raimondii] Length = 565 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = -3 Query: 538 MAGTPISRRVSTPFPRHGIISSSVKEKKGSKAVAATTPVNYVSLPKDDALSR 383 M GTP SRRVSTP +HG+ S++KE++ + V PVN+V+LPKDD +SR Sbjct: 514 MVGTPTSRRVSTPSGKHGV--SNLKERRETGRVNNVIPVNFVALPKDDPMSR 563 >gb|OMO88283.1| hypothetical protein CCACVL1_08490, partial [Corchorus capsularis] Length = 83 Score = 53.1 bits (126), Expect = 3e-06 Identities = 28/53 (52%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Frame = -3 Query: 538 MAGTPISRRVSTPFPRHGIISSSVKEKKGSKAV-AATTPVNYVSLPKDDALSR 383 M GTPI RRVSTP RHG++ +KE++ S V P+N+V+LPKDD SR Sbjct: 31 MVGTPIGRRVSTPSERHGVL--GLKERRESARVNYVIVPLNFVALPKDDPASR 81 >gb|PPD72363.1| hypothetical protein GOBAR_DD30728 [Gossypium barbadense] Length = 139 Score = 53.9 bits (128), Expect = 6e-06 Identities = 27/52 (51%), Positives = 37/52 (71%) Frame = -3 Query: 538 MAGTPISRRVSTPFPRHGIISSSVKEKKGSKAVAATTPVNYVSLPKDDALSR 383 M GTP SRRVSTP +HG+ S++KE++ + V PVN+V+L KDD +SR Sbjct: 88 MVGTPTSRRVSTPSGKHGV--SNLKERRETGRVNNVIPVNFVALTKDDPMSR 137 >ref|XP_008231710.1| PREDICTED: 65-kDa microtubule-associated protein 5-like [Prunus mume] ref|XP_008245531.1| PREDICTED: 65-kDa microtubule-associated protein 5-like [Prunus mume] Length = 565 Score = 56.2 bits (134), Expect = 6e-06 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = -3 Query: 538 MAGTPISRRVSTPFPRHGIISSSVKEKKGSKAVAATTPVNYVSLPKDDALSR 383 M GTPISRR TP RHG+ S+ KE++ S V TPVNYV+LPKDD++SR Sbjct: 516 MVGTPISRR--TPLGRHGV--SAGKERRESGRVHNLTPVNYVALPKDDSVSR 563 >ref|XP_007221047.1| 65-kDa microtubule-associated protein 5 [Prunus persica] gb|ONI21020.1| hypothetical protein PRUPE_2G045700 [Prunus persica] Length = 565 Score = 56.2 bits (134), Expect = 6e-06 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = -3 Query: 538 MAGTPISRRVSTPFPRHGIISSSVKEKKGSKAVAATTPVNYVSLPKDDALSR 383 M GTPISRR TP RHG+ S+ KE++ S V TPVNYV+LPKDD++SR Sbjct: 516 MVGTPISRR--TPLGRHGV--SAGKERRESGRVHNLTPVNYVALPKDDSVSR 563 >ref|XP_004308670.1| PREDICTED: 65-kDa microtubule-associated protein 5 [Fragaria vesca subsp. vesca] Length = 567 Score = 56.2 bits (134), Expect = 6e-06 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = -3 Query: 532 GTPISRRVSTPFPRHGIISSSVKEKKGSKAVAATTPVNYVSLPKDDALSR 383 GTPISRR TP RHG+ + + + G A TPVNYV+LPKDD++SR Sbjct: 519 GTPISRRTGTPLGRHGVSAGKERRESGR---ANMTPVNYVALPKDDSISR 565 >ref|XP_017616864.1| PREDICTED: 65-kDa microtubule-associated protein 5 [Gossypium arboreum] Length = 565 Score = 55.8 bits (133), Expect = 8e-06 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -3 Query: 538 MAGTPISRRVSTPFPRHGIISSSVKEKKGSKAVAATTPVNYVSLPKDDALSR 383 M GTP SRRVSTP +HG+ S++KE++ + V P+N+V+LPKDD +SR Sbjct: 514 MVGTPTSRRVSTPSGKHGV--SNLKERRETGRVNNVIPLNFVALPKDDPMSR 563