BLASTX nr result
ID: Ophiopogon27_contig00034597
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00034597 (393 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009045731.1| orf148b (mitochondrion) [Batis maritima] >gi... 57 2e-07 >ref|YP_009045731.1| orf148b (mitochondrion) [Batis maritima] gb|AIC83334.1| orf148b (mitochondrion) [Batis maritima] Length = 148 Score = 56.6 bits (135), Expect = 2e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 34 KALTKLLTESRLSLDAENFGCVRVDQRFGLLLPH 135 KAL +LLTES++SLD ENF C +VDQRFGLLLPH Sbjct: 75 KALAELLTESQISLDTENFLCAQVDQRFGLLLPH 108