BLASTX nr result
ID: Ophiopogon27_contig00034553
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00034553 (704 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_080490110.1| hypothetical protein [Enterococcus faecalis] 55 2e-06 ref|WP_073340576.1| MULTISPECIES: hypothetical protein [Enteroco... 55 2e-06 ref|WP_073495498.1| hypothetical protein [Enterococcus faecalis] 54 2e-06 ref|WP_073459402.1| hypothetical protein [Enterococcus faecalis] 54 4e-06 >ref|WP_080490110.1| hypothetical protein [Enterococcus faecalis] Length = 72 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -2 Query: 703 FFLMIRRPPRSTLFPYTTLFRSQILGIWPTSRVV 602 FFLMIRRPPRSTLFPYTTLFRS+ LG++ ++++ Sbjct: 17 FFLMIRRPPRSTLFPYTTLFRSKGLGVYRNNQLL 50 >ref|WP_073340576.1| MULTISPECIES: hypothetical protein [Enterococcus] Length = 105 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 704 FFFNDTATTEIYTLSLHDALPISNFGYLA 618 FFFNDTATTEIYTLSLHDALPI +FG+ A Sbjct: 19 FFFNDTATTEIYTLSLHDALPILSFGFAA 47 >ref|WP_073495498.1| hypothetical protein [Enterococcus faecalis] Length = 68 Score = 54.3 bits (129), Expect = 2e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +2 Query: 605 YSTRWPNTQNLRSEERRVGKECRSRWSPYH 694 Y T+W ++ RSEERRVGKECRSRWSPYH Sbjct: 39 YCTQWDFVEDRRSEERRVGKECRSRWSPYH 68 >ref|WP_073459402.1| hypothetical protein [Enterococcus faecalis] Length = 75 Score = 53.5 bits (127), Expect = 4e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -1 Query: 704 FFFNDTATTEIYTLSLHDALPISNFGY 624 FFFNDTATTEIYTLSLHDALPISN Y Sbjct: 14 FFFNDTATTEIYTLSLHDALPISNKRY 40