BLASTX nr result
ID: Ophiopogon27_contig00034299
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00034299 (484 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020266251.1| paired amphipathic helix protein Sin3-like 3... 55 6e-06 gb|ONK63229.1| uncharacterized protein A4U43_C07F12720 [Asparagu... 55 9e-06 >ref|XP_020266251.1| paired amphipathic helix protein Sin3-like 3 [Asparagus officinalis] Length = 315 Score = 55.5 bits (132), Expect = 6e-06 Identities = 24/54 (44%), Positives = 39/54 (72%) Frame = -1 Query: 451 VKVEANGDEII*RSKELFKGDDRLIIGLYNLLLDSRRKNERPDDFGGCF*YIFL 290 V +GDEII R++ELF G++ +++G YNL+L+++RK+ +PDD G F + L Sbjct: 37 VDKRVDGDEIIRRTEELFDGEEIMVMGFYNLMLNTKRKSRKPDDLGEVFNRVLL 90 >gb|ONK63229.1| uncharacterized protein A4U43_C07F12720 [Asparagus officinalis] Length = 586 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/49 (51%), Positives = 36/49 (73%) Frame = -1 Query: 451 VKVEANGDEII*RSKELFKGDDRLIIGLYNLLLDSRRKNERPDDFGGCF 305 V +GDEII R++ELF GD+ +++G YNL+LD+RRK+ + DD G F Sbjct: 272 VDKRVDGDEIIRRAEELFDGDEIMMMGFYNLMLDTRRKSRKLDDLGKVF 320