BLASTX nr result
ID: Ophiopogon27_contig00034276
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00034276 (489 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK57668.1| uncharacterized protein A4U43_C09F2850 [Asparagus... 64 4e-09 >gb|ONK57668.1| uncharacterized protein A4U43_C09F2850 [Asparagus officinalis] Length = 229 Score = 63.5 bits (153), Expect = 4e-09 Identities = 28/62 (45%), Positives = 42/62 (67%) Frame = +3 Query: 303 ASKVWIESDSARVVDLLNRNPDLSEEPILADCRLFINKLQECKVFHIYREGNAGADCMAN 482 A VWI DS V+DLL++ P ++ PIL +C+ I+ ++E K+ HI+RE NA D +AN Sbjct: 136 ACLVWIAGDSKHVLDLLSKEPYHTDSPILVNCKSIISSIEEYKISHIFREVNASGDLLAN 195 Query: 483 IG 488 +G Sbjct: 196 MG 197