BLASTX nr result
ID: Ophiopogon27_contig00034246
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00034246 (364 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY30704.1| hypothetical protein RhiirB3_418988, partial [Rhi... 67 3e-11 gb|PKY51222.1| hypothetical protein RhiirA4_407266 [Rhizophagus ... 67 3e-11 gb|PKC15434.1| hypothetical protein RhiirA5_349095 [Rhizophagus ... 67 3e-11 dbj|GBC13335.1| hypothetical protein RIR_0207300 [Rhizophagus ir... 67 3e-10 gb|EXX68149.1| hypothetical protein RirG_107740 [Rhizophagus irr... 67 3e-10 >gb|PKY30704.1| hypothetical protein RhiirB3_418988, partial [Rhizophagus irregularis] Length = 156 Score = 66.6 bits (161), Expect = 3e-11 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -1 Query: 328 DLDTNNGKNNRKKMVTFTVEPESITEPSSPILHGFTF 218 DLDTNNGKNNRKKMVTFTVEPES EPSSPI + F F Sbjct: 89 DLDTNNGKNNRKKMVTFTVEPESSIEPSSPISYSFAF 125 >gb|PKY51222.1| hypothetical protein RhiirA4_407266 [Rhizophagus irregularis] Length = 157 Score = 66.6 bits (161), Expect = 3e-11 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -1 Query: 328 DLDTNNGKNNRKKMVTFTVEPESITEPSSPILHGFTF 218 DLDTNNGKNNRKKMVTFTVEPES EPSSPI + F F Sbjct: 89 DLDTNNGKNNRKKMVTFTVEPESSIEPSSPISYSFAF 125 >gb|PKC15434.1| hypothetical protein RhiirA5_349095 [Rhizophagus irregularis] gb|PKC71102.1| hypothetical protein RhiirA1_453970 [Rhizophagus irregularis] gb|PKK78573.1| hypothetical protein RhiirC2_770054 [Rhizophagus irregularis] gb|POG66693.1| hypothetical protein GLOIN_2v1482111 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 157 Score = 66.6 bits (161), Expect = 3e-11 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -1 Query: 328 DLDTNNGKNNRKKMVTFTVEPESITEPSSPILHGFTF 218 DLDTNNGKNNRKKMVTFTVEPES EPSSPI + F F Sbjct: 89 DLDTNNGKNNRKKMVTFTVEPESSIEPSSPISYSFAF 125 >dbj|GBC13335.1| hypothetical protein RIR_0207300 [Rhizophagus irregularis DAOM 181602] Length = 421 Score = 66.6 bits (161), Expect = 3e-10 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -1 Query: 328 DLDTNNGKNNRKKMVTFTVEPESITEPSSPILHGFTF 218 DLDTNNGKNNRKKMVTFTVEPES EPSSPI + F F Sbjct: 353 DLDTNNGKNNRKKMVTFTVEPESSIEPSSPISYSFAF 389 >gb|EXX68149.1| hypothetical protein RirG_107740 [Rhizophagus irregularis DAOM 197198w] Length = 421 Score = 66.6 bits (161), Expect = 3e-10 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -1 Query: 328 DLDTNNGKNNRKKMVTFTVEPESITEPSSPILHGFTF 218 DLDTNNGKNNRKKMVTFTVEPES EPSSPI + F F Sbjct: 353 DLDTNNGKNNRKKMVTFTVEPESSIEPSSPISYSFAF 389