BLASTX nr result
ID: Ophiopogon27_contig00034181
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00034181 (355 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK60017.1| uncharacterized protein A4U43_C08F13330 [Asparagu... 117 5e-31 ref|XP_020242879.1| LOW QUALITY PROTEIN: probable indole-3-aceti... 117 2e-30 ref|XP_021912290.1| probable indole-3-acetic acid-amido syntheta... 112 1e-28 ref|XP_023748146.1| probable indole-3-acetic acid-amido syntheta... 115 1e-28 ref|XP_002524947.1| PREDICTED: probable indole-3-acetic acid-ami... 113 4e-28 emb|CAN70815.1| hypothetical protein VITISV_042944 [Vitis vinifera] 113 5e-28 ref|XP_002283886.1| PREDICTED: probable indole-3-acetic acid-ami... 113 5e-28 ref|XP_021983258.1| probable indole-3-acetic acid-amido syntheta... 113 5e-28 ref|XP_010271511.1| PREDICTED: probable indole-3-acetic acid-ami... 113 5e-28 ref|XP_010277152.1| PREDICTED: probable indole-3-acetic acid-ami... 110 7e-28 ref|XP_023920786.1| probable indole-3-acetic acid-amido syntheta... 114 9e-28 ref|XP_021632253.1| probable indole-3-acetic acid-amido syntheta... 114 1e-27 gb|EPS68048.1| hypothetical protein M569_06726, partial [Genlise... 108 1e-27 ref|XP_011099346.1| probable indole-3-acetic acid-amido syntheta... 112 2e-27 gb|PON90598.1| GH3-like hormone conjugating enzyme [Trema orient... 113 2e-27 gb|PON74762.1| GH3-like hormone conjugating enzyme [Parasponia a... 113 2e-27 gb|PPD93275.1| hypothetical protein GOBAR_DD09759 [Gossypium bar... 114 2e-27 ref|XP_016691639.1| PREDICTED: probable indole-3-acetic acid-ami... 114 2e-27 ref|XP_012480180.1| PREDICTED: probable indole-3-acetic acid-ami... 114 2e-27 ref|XP_021908038.1| probable indole-3-acetic acid-amido syntheta... 112 2e-27 >gb|ONK60017.1| uncharacterized protein A4U43_C08F13330 [Asparagus officinalis] Length = 185 Score = 117 bits (294), Expect = 5e-31 Identities = 56/67 (83%), Positives = 60/67 (89%) Frame = -1 Query: 202 PANGPTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGA 23 P +GP VL +CCLAMEEE+N VYRQ RVADGSIGPLEIR+VRPGTFEELMDYAISRGA Sbjct: 84 PDHGPGQAVLEKCCLAMEEELNTVYRQSRVADGSIGPLEIRVVRPGTFEELMDYAISRGA 143 Query: 22 SINQYKV 2 SINQYKV Sbjct: 144 SINQYKV 150 >ref|XP_020242879.1| LOW QUALITY PROTEIN: probable indole-3-acetic acid-amido synthetase GH3.1 [Asparagus officinalis] Length = 529 Score = 117 bits (294), Expect(2) = 2e-30 Identities = 56/67 (83%), Positives = 60/67 (89%) Frame = -1 Query: 202 PANGPTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGA 23 P +GP VL +CCLAMEEE+N VYRQ RVADGSIGPLEIR+VRPGTFEELMDYAISRGA Sbjct: 428 PDHGPGQAVLEKCCLAMEEELNTVYRQSRVADGSIGPLEIRVVRPGTFEELMDYAISRGA 487 Query: 22 SINQYKV 2 SINQYKV Sbjct: 488 SINQYKV 494 Score = 42.4 bits (98), Expect(2) = 2e-30 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 254 RTIPGHYVIYWELLLRSP 201 RTIPGHYVIYWELLLR+P Sbjct: 411 RTIPGHYVIYWELLLRNP 428 >ref|XP_021912290.1| probable indole-3-acetic acid-amido synthetase GH3.1 [Carica papaya] Length = 599 Score = 112 bits (279), Expect(2) = 1e-28 Identities = 54/67 (80%), Positives = 59/67 (88%) Frame = -1 Query: 202 PANGPTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGA 23 PAN P+ VL +CCL MEE +N+VYRQGRVAD SIGPLEIR+VR GTFEELMDYAISRGA Sbjct: 498 PANWPSEQVLNQCCLEMEESLNSVYRQGRVADNSIGPLEIRVVRSGTFEELMDYAISRGA 557 Query: 22 SINQYKV 2 SINQYKV Sbjct: 558 SINQYKV 564 Score = 42.4 bits (98), Expect(2) = 1e-28 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -3 Query: 254 RTIPGHYVIYWELLLRSPREW 192 +TIPGHYVIYWELL++ P W Sbjct: 481 KTIPGHYVIYWELLVKDPANW 501 >ref|XP_023748146.1| probable indole-3-acetic acid-amido synthetase GH3.1 [Lactuca sativa] gb|PLY62906.1| hypothetical protein LSAT_4X162960 [Lactuca sativa] Length = 599 Score = 115 bits (287), Expect(2) = 1e-28 Identities = 55/67 (82%), Positives = 60/67 (89%) Frame = -1 Query: 202 PANGPTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGA 23 PANGP VLA+CCLAMEE +N+VYRQ RVAD SIGPLEIR+V+ GTFEELMDYAISRGA Sbjct: 498 PANGPPENVLAQCCLAMEEALNSVYRQSRVADNSIGPLEIRVVKNGTFEELMDYAISRGA 557 Query: 22 SINQYKV 2 SINQYKV Sbjct: 558 SINQYKV 564 Score = 38.9 bits (89), Expect(2) = 1e-28 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -3 Query: 254 RTIPGHYVIYWELLLRSP 201 +TIPGHYVIYWELL++ P Sbjct: 481 KTIPGHYVIYWELLMKDP 498 >ref|XP_002524947.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 [Ricinus communis] gb|EEF37444.1| Indole-3-acetic acid-amido synthetase GH3.3, putative [Ricinus communis] Length = 598 Score = 113 bits (283), Expect(2) = 4e-28 Identities = 54/67 (80%), Positives = 60/67 (89%) Frame = -1 Query: 202 PANGPTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGA 23 P+N PT VL +CCLAMEE +N+VYRQGRVAD SIGPLEIR+V+ GTFEELMDYAISRGA Sbjct: 497 PSNSPTEQVLNQCCLAMEESLNSVYRQGRVADSSIGPLEIRVVKNGTFEELMDYAISRGA 556 Query: 22 SINQYKV 2 SINQYKV Sbjct: 557 SINQYKV 563 Score = 38.9 bits (89), Expect(2) = 4e-28 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -3 Query: 254 RTIPGHYVIYWELLLRSP 201 +TIPGHYVIYWELL++ P Sbjct: 480 KTIPGHYVIYWELLIKDP 497 >emb|CAN70815.1| hypothetical protein VITISV_042944 [Vitis vinifera] Length = 607 Score = 113 bits (283), Expect(2) = 5e-28 Identities = 54/67 (80%), Positives = 59/67 (88%) Frame = -1 Query: 202 PANGPTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGA 23 P+N PT VL +CCLAMEE +N VYRQGRVAD SIGPLEIR+V+ GTFEELMDYAISRGA Sbjct: 497 PSNSPTDTVLKQCCLAMEESLNTVYRQGRVADNSIGPLEIRVVKSGTFEELMDYAISRGA 556 Query: 22 SINQYKV 2 SINQYKV Sbjct: 557 SINQYKV 563 Score = 38.5 bits (88), Expect(2) = 5e-28 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -3 Query: 254 RTIPGHYVIYWELLLRSP 201 +TIPGHYVIYWELL++ P Sbjct: 480 KTIPGHYVIYWELLVKDP 497 >ref|XP_002283886.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 [Vitis vinifera] Length = 600 Score = 113 bits (283), Expect(2) = 5e-28 Identities = 54/67 (80%), Positives = 59/67 (88%) Frame = -1 Query: 202 PANGPTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGA 23 P+N PT VL +CCLAMEE +N VYRQGRVAD SIGPLEIR+V+ GTFEELMDYAISRGA Sbjct: 497 PSNSPTDTVLKQCCLAMEESLNTVYRQGRVADNSIGPLEIRVVKSGTFEELMDYAISRGA 556 Query: 22 SINQYKV 2 SINQYKV Sbjct: 557 SINQYKV 563 Score = 38.5 bits (88), Expect(2) = 5e-28 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -3 Query: 254 RTIPGHYVIYWELLLRSP 201 +TIPGHYVIYWELL++ P Sbjct: 480 KTIPGHYVIYWELLVKDP 497 >ref|XP_021983258.1| probable indole-3-acetic acid-amido synthetase GH3.1 [Helianthus annuus] gb|OTG15804.1| putative GH3 family [Helianthus annuus] Length = 599 Score = 113 bits (282), Expect(2) = 5e-28 Identities = 55/67 (82%), Positives = 59/67 (88%) Frame = -1 Query: 202 PANGPTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGA 23 P NGPT VL +CCLAMEE +N+VYRQ RVAD SIGPLEIRIV+ GTFEELMDYAISRGA Sbjct: 498 PTNGPTDDVLDQCCLAMEESLNSVYRQSRVADNSIGPLEIRIVQNGTFEELMDYAISRGA 557 Query: 22 SINQYKV 2 SINQYKV Sbjct: 558 SINQYKV 564 Score = 38.9 bits (89), Expect(2) = 5e-28 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -3 Query: 254 RTIPGHYVIYWELLLRSP 201 +TIPGHYVIYWELL++ P Sbjct: 481 KTIPGHYVIYWELLIKDP 498 >ref|XP_010271511.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 [Nelumbo nucifera] Length = 595 Score = 113 bits (283), Expect(2) = 5e-28 Identities = 54/67 (80%), Positives = 59/67 (88%) Frame = -1 Query: 202 PANGPTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGA 23 P NGPT VL +CCLAMEE +N+VYRQGRVAD SIGPLEIR+V+ GTFE LMDYAISRGA Sbjct: 494 PGNGPTDEVLNKCCLAMEESLNSVYRQGRVADNSIGPLEIRVVKSGTFEALMDYAISRGA 553 Query: 22 SINQYKV 2 SINQYKV Sbjct: 554 SINQYKV 560 Score = 38.5 bits (88), Expect(2) = 5e-28 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -3 Query: 254 RTIPGHYVIYWELLLRSP 201 +TIPGHYVIYWELL++ P Sbjct: 477 KTIPGHYVIYWELLVKDP 494 >ref|XP_010277152.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 [Nelumbo nucifera] Length = 599 Score = 110 bits (275), Expect(2) = 7e-28 Identities = 53/67 (79%), Positives = 58/67 (86%) Frame = -1 Query: 202 PANGPTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGA 23 P+N PT VL CCLAMEE +N+VYRQGRVAD SIGPLEIR+V+ GTFE LMDYAISRGA Sbjct: 498 PSNWPTEQVLNNCCLAMEESLNSVYRQGRVADNSIGPLEIRVVKSGTFEALMDYAISRGA 557 Query: 22 SINQYKV 2 SINQYKV Sbjct: 558 SINQYKV 564 Score = 41.2 bits (95), Expect(2) = 7e-28 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -3 Query: 257 ARTIPGHYVIYWELLLRSPREW 192 +++IPGHYVIYWELL++ P W Sbjct: 480 SKSIPGHYVIYWELLVKDPSNW 501 >ref|XP_023920786.1| probable indole-3-acetic acid-amido synthetase GH3.1 [Quercus suber] gb|POE99961.1| putative indole-3-acetic acid-amido synthetase gh3.1 [Quercus suber] Length = 603 Score = 114 bits (285), Expect(2) = 9e-28 Identities = 55/67 (82%), Positives = 59/67 (88%) Frame = -1 Query: 202 PANGPTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGA 23 PAN PT VL +CCL MEE MN+VYRQGRVAD SIGPLEIR+V+ GTFEELMDYAISRGA Sbjct: 502 PANSPTEEVLNQCCLVMEESMNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRGA 561 Query: 22 SINQYKV 2 SINQYKV Sbjct: 562 SINQYKV 568 Score = 37.0 bits (84), Expect(2) = 9e-28 Identities = 13/18 (72%), Positives = 17/18 (94%) Frame = -3 Query: 254 RTIPGHYVIYWELLLRSP 201 ++IPGHYVIYWELL++ P Sbjct: 485 KSIPGHYVIYWELLVKDP 502 >ref|XP_021632253.1| probable indole-3-acetic acid-amido synthetase GH3.1 [Manihot esculenta] gb|OAY33682.1| hypothetical protein MANES_13G116000 [Manihot esculenta] Length = 598 Score = 114 bits (286), Expect(2) = 1e-27 Identities = 55/67 (82%), Positives = 60/67 (89%) Frame = -1 Query: 202 PANGPTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGA 23 PAN PT VL +CCLAMEE +N+VYRQGRVAD SIGPLEIR+V+ GTFEELMDYAISRGA Sbjct: 497 PANSPTEEVLNQCCLAMEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRGA 556 Query: 22 SINQYKV 2 SINQYKV Sbjct: 557 SINQYKV 563 Score = 36.2 bits (82), Expect(2) = 1e-27 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 254 RTIPGHYVIYWELLLRSP 201 + IPGHYVIYWELL++ P Sbjct: 480 KRIPGHYVIYWELLVKDP 497 >gb|EPS68048.1| hypothetical protein M569_06726, partial [Genlisea aurea] Length = 155 Score = 108 bits (269), Expect = 1e-27 Identities = 53/63 (84%), Positives = 56/63 (88%) Frame = -1 Query: 190 PTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGASINQ 11 P GVL RCCLAMEE +N+VYRQ RVADGSIGPLEIR+V GTFEELMDYAISRGASINQ Sbjct: 59 PEEGVLERCCLAMEESLNSVYRQCRVADGSIGPLEIRVVGNGTFEELMDYAISRGASINQ 118 Query: 10 YKV 2 YKV Sbjct: 119 YKV 121 >ref|XP_011099346.1| probable indole-3-acetic acid-amido synthetase GH3.1 [Sesamum indicum] Length = 600 Score = 112 bits (279), Expect(2) = 2e-27 Identities = 53/66 (80%), Positives = 58/66 (87%) Frame = -1 Query: 202 PANGPTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGA 23 PA+ PT VLA+CC AMEE MN+VYRQ RVAD S+GPLEIR+VR GTFEELMDYAISRGA Sbjct: 499 PAHAPTGEVLAQCCFAMEESMNSVYRQSRVADNSVGPLEIRVVRNGTFEELMDYAISRGA 558 Query: 22 SINQYK 5 SINQYK Sbjct: 559 SINQYK 564 Score = 38.5 bits (88), Expect(2) = 2e-27 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -3 Query: 254 RTIPGHYVIYWELLLRSP 201 +TIPGHYVIYWELL++ P Sbjct: 482 KTIPGHYVIYWELLVKDP 499 >gb|PON90598.1| GH3-like hormone conjugating enzyme [Trema orientalis] Length = 599 Score = 113 bits (282), Expect(2) = 2e-27 Identities = 54/67 (80%), Positives = 58/67 (86%) Frame = -1 Query: 202 PANGPTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGA 23 P N P VL+RCCL MEE +N+VYRQGRVAD SIGPLEIR+VR GTFEELMDYAISRGA Sbjct: 498 PVNAPDDDVLSRCCLEMEESLNSVYRQGRVADNSIGPLEIRVVRSGTFEELMDYAISRGA 557 Query: 22 SINQYKV 2 SINQYKV Sbjct: 558 SINQYKV 564 Score = 37.4 bits (85), Expect(2) = 2e-27 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -3 Query: 251 TIPGHYVIYWELLLRSP 201 TIPGHYV+YWELL++ P Sbjct: 482 TIPGHYVVYWELLVKDP 498 >gb|PON74762.1| GH3-like hormone conjugating enzyme [Parasponia andersonii] Length = 599 Score = 113 bits (282), Expect(2) = 2e-27 Identities = 54/67 (80%), Positives = 58/67 (86%) Frame = -1 Query: 202 PANGPTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGA 23 P N P VL+RCCL MEE +N+VYRQGRVAD SIGPLEIR+VR GTFEELMDYAISRGA Sbjct: 498 PVNAPDDDVLSRCCLEMEESLNSVYRQGRVADNSIGPLEIRVVRSGTFEELMDYAISRGA 557 Query: 22 SINQYKV 2 SINQYKV Sbjct: 558 SINQYKV 564 Score = 37.4 bits (85), Expect(2) = 2e-27 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -3 Query: 251 TIPGHYVIYWELLLRSP 201 TIPGHYV+YWELL++ P Sbjct: 482 TIPGHYVVYWELLVKDP 498 >gb|PPD93275.1| hypothetical protein GOBAR_DD09759 [Gossypium barbadense] Length = 598 Score = 114 bits (286), Expect(2) = 2e-27 Identities = 56/66 (84%), Positives = 59/66 (89%) Frame = -1 Query: 199 ANGPTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGAS 20 AN PT VL +CCLAMEE MN+VYRQGRVAD SIGPLEIR+VR GTFEELMDYAISRGAS Sbjct: 498 ANSPTDDVLKQCCLAMEESMNSVYRQGRVADNSIGPLEIRVVRNGTFEELMDYAISRGAS 557 Query: 19 INQYKV 2 INQYKV Sbjct: 558 INQYKV 563 Score = 35.8 bits (81), Expect(2) = 2e-27 Identities = 13/16 (81%), Positives = 16/16 (100%) Frame = -3 Query: 254 RTIPGHYVIYWELLLR 207 +TIPGHYVIYWELL++ Sbjct: 480 KTIPGHYVIYWELLVK 495 Score = 61.6 bits (148), Expect = 1e-08 Identities = 32/56 (57%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = -2 Query: 351 GAVFASSLCRAIRFLQLNWSELTRDIELGTLSQDHTGP-LRDLLGAAAAQPPRMGR 187 GAVFAS L RAIRFLQLNW +L++DIE GTL+Q T P LR+ +G P + R Sbjct: 227 GAVFASGLLRAIRFLQLNWRQLSQDIETGTLNQKVTDPSLRECMGKILKPDPELAR 282 >ref|XP_016691639.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 [Gossypium hirsutum] Length = 598 Score = 114 bits (286), Expect(2) = 2e-27 Identities = 56/66 (84%), Positives = 59/66 (89%) Frame = -1 Query: 199 ANGPTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGAS 20 AN PT VL +CCLAMEE MN+VYRQGRVAD SIGPLEIR+VR GTFEELMDYAISRGAS Sbjct: 498 ANSPTDDVLKQCCLAMEESMNSVYRQGRVADNSIGPLEIRVVRNGTFEELMDYAISRGAS 557 Query: 19 INQYKV 2 INQYKV Sbjct: 558 INQYKV 563 Score = 35.8 bits (81), Expect(2) = 2e-27 Identities = 13/16 (81%), Positives = 16/16 (100%) Frame = -3 Query: 254 RTIPGHYVIYWELLLR 207 +TIPGHYVIYWELL++ Sbjct: 480 KTIPGHYVIYWELLVK 495 Score = 61.6 bits (148), Expect = 1e-08 Identities = 32/56 (57%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = -2 Query: 351 GAVFASSLCRAIRFLQLNWSELTRDIELGTLSQDHTGP-LRDLLGAAAAQPPRMGR 187 GAVFAS L RAIRFLQLNW +L++DIE GTL+Q T P LR+ +G P + R Sbjct: 227 GAVFASGLLRAIRFLQLNWRQLSQDIETGTLNQKVTDPSLRECMGKILKPDPELAR 282 >ref|XP_012480180.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 [Gossypium raimondii] gb|KJB32300.1| hypothetical protein B456_005G234200 [Gossypium raimondii] Length = 598 Score = 114 bits (286), Expect(2) = 2e-27 Identities = 56/66 (84%), Positives = 59/66 (89%) Frame = -1 Query: 199 ANGPTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGAS 20 AN PT VL +CCLAMEE MN+VYRQGRVAD SIGPLEIR+VR GTFEELMDYAISRGAS Sbjct: 498 ANSPTDDVLKQCCLAMEESMNSVYRQGRVADNSIGPLEIRVVRNGTFEELMDYAISRGAS 557 Query: 19 INQYKV 2 INQYKV Sbjct: 558 INQYKV 563 Score = 35.8 bits (81), Expect(2) = 2e-27 Identities = 13/16 (81%), Positives = 16/16 (100%) Frame = -3 Query: 254 RTIPGHYVIYWELLLR 207 +TIPGHYVIYWELL++ Sbjct: 480 KTIPGHYVIYWELLVK 495 Score = 61.6 bits (148), Expect = 1e-08 Identities = 32/56 (57%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = -2 Query: 351 GAVFASSLCRAIRFLQLNWSELTRDIELGTLSQDHTGP-LRDLLGAAAAQPPRMGR 187 GAVFAS L RAIRFLQLNW +L++DIE GTL+Q T P LR+ +G P + R Sbjct: 227 GAVFASGLLRAIRFLQLNWRQLSQDIETGTLNQKVTDPSLRECMGKILKPDPELAR 282 >ref|XP_021908038.1| probable indole-3-acetic acid-amido synthetase GH3.1 [Carica papaya] Length = 599 Score = 112 bits (280), Expect(2) = 2e-27 Identities = 54/67 (80%), Positives = 60/67 (89%) Frame = -1 Query: 202 PANGPTAGVLARCCLAMEEEMNAVYRQGRVADGSIGPLEIRIVRPGTFEELMDYAISRGA 23 PAN PT VL +CCLAMEE +N+VYRQGRVAD SIGPLEIR+V+ GTFE+LMDYAISRGA Sbjct: 498 PANFPTHEVLNQCCLAMEESLNSVYRQGRVADNSIGPLEIRVVKSGTFEDLMDYAISRGA 557 Query: 22 SINQYKV 2 SINQYKV Sbjct: 558 SINQYKV 564 Score = 37.7 bits (86), Expect(2) = 2e-27 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -3 Query: 254 RTIPGHYVIYWELLLRSP 201 +TIPGHYVIYWELL + P Sbjct: 481 KTIPGHYVIYWELLAKDP 498