BLASTX nr result
ID: Ophiopogon27_contig00034140
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00034140 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PPD71372.1| hypothetical protein GOBAR_DD31748 [Gossypium bar... 70 4e-12 >gb|PPD71372.1| hypothetical protein GOBAR_DD31748 [Gossypium barbadense] Length = 208 Score = 70.5 bits (171), Expect = 4e-12 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -3 Query: 404 TLRSASTKKATPSRSGRIKPIISAGTAMYVFDFLFTHDRA 285 TL SASTKKATPS+SGRI P ISAGTAMYVFDFLFTHD A Sbjct: 164 TLHSASTKKATPSKSGRIIPSISAGTAMYVFDFLFTHDLA 203