BLASTX nr result
ID: Ophiopogon27_contig00034092
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00034092 (641 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK57668.1| uncharacterized protein A4U43_C09F2850 [Asparagus... 63 2e-08 >gb|ONK57668.1| uncharacterized protein A4U43_C09F2850 [Asparagus officinalis] Length = 229 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/53 (50%), Positives = 37/53 (69%) Frame = -3 Query: 339 FKISHIYREGNVGANLMANYGCNVESFTLWERDFPDNLLSALERDRAGPYVRM 181 +KISHI+RE N +L+AN GC S LWE + P LL+++ERD GP+VR+ Sbjct: 177 YKISHIFREVNASGDLLANMGCGTTSSILWEFEIPGTLLASVERDMRGPFVRL 229