BLASTX nr result
ID: Ophiopogon27_contig00033885
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00033885 (415 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK75603.1| uncharacterized protein A4U43_C03F18630 [Asparagu... 76 2e-13 >gb|ONK75603.1| uncharacterized protein A4U43_C03F18630 [Asparagus officinalis] Length = 1739 Score = 76.3 bits (186), Expect = 2e-13 Identities = 40/55 (72%), Positives = 44/55 (80%) Frame = +2 Query: 251 AIDYLISSLPSPPKDPLVFPSRGGLAGERNTAAKLLFPSASDALNAVDFLWRRRL 415 +ID LI+SLP PPKDPLVFPSR E+ TAAKL FPS SDAL+AV FLWRRRL Sbjct: 65 SIDDLIASLPCPPKDPLVFPSR-----EKRTAAKLFFPSLSDALDAVIFLWRRRL 114