BLASTX nr result
ID: Ophiopogon27_contig00033762
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00033762 (461 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245436.1| uncharacterized protein LOC109823570 [Aspara... 58 7e-07 >ref|XP_020245436.1| uncharacterized protein LOC109823570 [Asparagus officinalis] Length = 342 Score = 57.8 bits (138), Expect = 7e-07 Identities = 26/50 (52%), Positives = 34/50 (68%) Frame = -3 Query: 150 KPGTVSDFRRLNPTTFTGEETPLDSEQWIVDMENLLTAARISDADRVGVV 1 +PG VSDFR+LNP F G E ++E W+ M+ LL AA+I D DRV +V Sbjct: 45 RPGNVSDFRKLNPQHFAGTEGGYEAEMWLQTMDRLLRAAKIPDEDRVDIV 94